KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0725Help
Entry
AciM339_0725      CDS       T02396                                 

Definition
AMP phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    AciM339_0725
Enzymes [BR:acf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     AciM339_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628153..629670)
Genome map
AA seq 505 aa AA seqDB search
MELKVKRIDVEVGGLEIILNEEDAKELGLHPQDRVKVTRRGTVTTAIVNISESMIKRGEI
GMFVEISEKLSVKNGDKVNIAPTVRPMSVDYIKKKISGEKLTKDEIYQIVRDIVDDSLSN
IELASYVTAIQIRGMDMDETEWMTKAMVETGETIDFEYTVFDVHSIGGVPGNKYAPIAVP
IAASMGLKIPKTSSRAISSAAGTADLMEVLTNVKLSVKDIRRIVDEVGATLTWGGAVNLA
PADDKIVKVEYPLGIDPHSQVLASVMAKKKAVGANYMVLDIPMGPETKVPDEKTARKYAM
DFIELGERLGITIEAAVTYGGQPIGRAIGPALEAREAMQALEGKNVSNSLIEKATDIAGM
LLELGNVAERGEGKAMAKNVLKSGKAREKFLEIINAQGSRGIEKSEDVPIGKYKAEIHSP
EDGYISIVSNKALVKIARTAGAPKDKGAGILLNRKKSEKTEKGEVLYVIYADSKAKLEEA
VKLAKMLKPLKIEGMLLERIPSYKK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
ttggaattgaaggtaaagaggattgatgttgaggttggaggattggagatcatactgaac
gaggaagatgcaaaggaacttgggctccacccacaggacagggttaaggtcacaaggagg
ggcactgtcacaacggccatagtgaacatttctgaaagtatgattaaaaggggagagata
gggatgttcgttgagatcagtgagaaattaagcgtaaaaaatggagataaggtgaacatc
gctccaactgtgagacccatgagtgtggattatataaagaaaaagatctccggtgaaaaa
ctcacaaaggatgagatatatcagatcgtgagagacattgtggatgatagtctatcaaac
attgaactggcatcctatgtaacggcgattcagattcgtggcatggacatggatgagacc
gagtggatgacaaaggcgatggtggaaacaggcgaaacaattgattttgaatacacagtg
tttgatgttcacagcataggaggagtacccggaaataagtatgcacccatagctgtaccc
atagcggccagcatgggattgaaaatacccaaaacctcatcaagggccataagcagtgcc
gcaggcacggcggatctaatggaagtccttacaaatgttaaacttagtgtaaaggatata
aggagaatagtagacgaggttggagccacgctcacatggggcggcgcggttaatcttgca
cctgcagacgataagattgtgaaggttgaatatccactgggaatcgacccgcattctcag
gttttagcaagcgtgatggcaaaaaagaaggctgtgggcgcaaattacatggttcttgac
attccaatgggtccagaaactaaagtgcctgacgagaagaccgcaagaaaatacgccatg
gatttcatagaacttggggagaggttaggcataaccattgaggcagccgtgacctacggt
ggacagccaattggccgtgccattggcccagcccttgaggcccgtgaggcgatgcaggcc
cttgaagggaaaaatgtaagtaactcgctcattgaaaaggcaacggacattgcgggcatg
ctccttgaacttggaaatgtggcagagaggggagagggaaaggcaatggcaaaaaatgtt
ttgaaaagtggaaaggcaagggagaagtttcttgaaatcatcaatgcccagggttcaagg
ggaattgaaaagagcgaggatgtccccataggcaaatacaaagcagaaatacattcaccg
gaagacggatacatctcaatagtctcaaataaagcgctggtgaagattgcaagaactgca
ggagccccaaaggacaagggtgcaggaatattgctcaacaggaaaaagagtgagaaaact
gaaaagggagaagtactgtatgtgatctatgcggattccaaggccaaactggaagaagca
gttaaactagccaaaatgttaaaacccctaaaaattgagggaatgctgctggagcgtatt
ccatcctacaaaaaatga

DBGET integrated database retrieval system