KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0763Help
Entry
AciM339_0763      CDS       T02396                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00187  
2-oxoisovalerate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.7]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Valine, leucine and isoleucine degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AciM339_0763
Enzymes [BR:acf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.7  3-methyl-2-oxobutanoate dehydrogenase (ferredoxin)
     AciM339_0763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(668385..669287)
Genome map
AA seq 300 aa AA seqDB search
MRKLTIPEEEYMLPGHTACLGCGATIAMRYVLKALGKNTILSIPACCWAVIPGVYPHRTL
EVPLLYTAFEVTGAAISGIREALNAMGKEDVNVVGFAGDGGTADIGLQALSGAMERGHDV
FYIMYDNEAYMNTGIQRSGSTPPGAWTTTTPGGKKRMYKWEPKKSVAEIMVAHHIPYVAT
ATIAYPEDMIAKLRRAKEIKGPKFIQIFSPCPTGWKHSPDKTVEISRLAVQTNAFPLYEV
VNGKYRITVRPKNPKPIKEYLRLQGRFRHLTEEEIARIQEYVNENWKALLKKERCSQEEE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaattaacaatacctgaggaagaatatatgctcccggggcacaccgcatgcctt
ggatgtggagcaaccatagcaatgcgctatgttctcaaggccttgggaaagaacaccata
ttatccatacctgcctgctgctgggccgttatacctggagtttaccctcaccgtaccctt
gaggtgcctttgctatacacagcctttgaggtaacgggtgctgccatatccggcataagg
gaggcactcaacgccatgggcaaggaggatgtgaacgttgttggatttgcaggagatgga
ggcacggccgatattggcctccaagccctgagcggagcaatggagcgcggtcatgatgta
ttctacataatgtacgataacgaggcgtatatgaacacgggtattcagcgctctggctcc
acacctccaggtgcgtggaccacaacaacccctggaggaaagaaaaggatgtacaagtgg
gagccgaagaagagcgtggctgagatcatggttgcccaccacatcccctatgtggccacc
gcaacaatagcgtatcctgaggatatgatcgcaaaattgaggagggcaaaggagataaag
ggtcccaaattcattcagatcttctccccatgcccaacgggatggaaacacagtccggat
aaaaccgtggaaatctcacgcttggcagtgcagacaaatgcatttcctctctacgaagtg
gtcaatggcaaatacagaataactgtgaggccaaagaatcccaaaccaataaaggagtac
ctccgcctacagggaaggttcagacatctcaccgaggaggaaattgcgaggattcaggag
tacgttaacgagaactggaaagccctgctcaagaaggagcgctgctctcaggaggaggaa
tga

DBGET integrated database retrieval system