KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0766Help
Entry
AciM339_0766      CDS       T02396                                 

Definition
2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciM339_0766
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciM339_0766
   00020 Citrate cycle (TCA cycle)
    AciM339_0766
   00620 Pyruvate metabolism
    AciM339_0766
   00640 Propanoate metabolism
    AciM339_0766
   00650 Butanoate metabolism
    AciM339_0766
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AciM339_0766
   00680 Methane metabolism
    AciM339_0766
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AciM339_0766
Enzymes [BR:acf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AciM339_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(670797..671357)
Genome map
AA seq 186 aa AA seqDB search
MIEIRFHGRGGQGSVIASKILAKAFFMEGKYVSSFPYFGVERRGAPVTAFTRVDDKPIRA
KYQIYDPDYVIVLDPSLIKAVDVLRGIKEDGWVLVNTMKSPKELKKMLDFPKVATVDATT
IAIRHRLGSQAAPIVNTAILGAFARISGLVKIETVMDAIREGAPVKKEDNAQAAKEAYEH
TNLGGD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatacgttttcacggaagaggtggacagggatctgtcatagcatcaaagatc
ctggcaaaggccttctttatggagggtaagtacgtgtcctccttcccctacttcggtgtt
gagcgtcgcggtgcacctgtgactgcgttcaccagggtggatgataagccgataagggca
aagtatcagatatacgaccctgattacgtcatagttctagacccatcgctcataaaggct
gtggatgttcttaggggaataaaagaggatggctgggttctcgtaaataccatgaagagc
ccaaaggaactaaagaagatgctagattttcccaaggtggcaactgtggatgcaaccacg
atagcgataagacatcgcctaggctcccaggccgcaccaattgtgaataccgcaattctt
ggtgcctttgccagaataagcggactcgtgaagatagaaaccgttatggacgcaattcgc
gagggtgctcccgtaaagaaggaggataatgcccaggccgccaaggaggcctacgagcat
acaaatttaggaggtgattga

DBGET integrated database retrieval system