KEGG   Aciduliprofundum sp. MAR08-339: AciM339_0829Help
Entry
AciM339_0829      CDS       T02396                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acf  Aciduliprofundum sp. MAR08-339
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
735370..736005
Genome map
AA seq 211 aa AA seqDB search
MNNEAMVHTLEMHGYIKSRRVKDAFLKVDRANFVPEEHRSHAYFDDPIPIGHAQTISAPS
MVAVMLELLDVFEGAKVLEVGTGSGYNACLMGCIGAEVYSIERIPELRKLAKKNMENCPC
KDNVHLLLGDGSVGYEEEAPYDRIIVTCGAPDIPEPLKEQLKCGGIMVIPVGGTFFQELY
VLRKERHGWRKRVWGDVAFVPLVGRYGHRWA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacgaggcaatggttcatacactggaaatgcacggatacataaagagcaggaga
gtgaaagatgcatttttgaaagttgatagagcgaattttgtgcctgaggagcacaggagc
cacgcgtattttgacgatcccattcccatagggcacgctcaaaccataagtgctcccagt
atggtggctgttatgcttgaacttcttgatgtgtttgaaggggcaaaggttcttgaagtt
ggtacaggttcagggtataatgcctgtcttatgggatgcataggtgcggaggtttacagc
attgagagaatacccgagttaaggaagctggcaaagaaaaatatggaaaattgcccctgc
aaggataatgtgcatcttctgttgggagatggctctgtgggttacgaagaggaggcaccc
tatgacaggataatagttacctgtggtgctcctgacattccggaaccactaaaggagcag
ttaaaatgcggaggcatcatggttatacccgtgggtggcacattctttcaggagctctac
gtgcttagaaaggagaggcatggatggagaaaaagggtttggggtgatgtggcctttgtg
cccctggtgggaaggtacgggcacaggtgggcttaa

DBGET integrated database retrieval system