KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1065Help
Entry
AciM339_1065      CDS       T02396                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:acf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(964848..966056)
Genome map
AA seq 402 aa AA seqDB search
MEKVFEKLESMREELIQFTIEMNRIKAVNPAGGGEGEEKRADWLEKKLREICDEVERYDT
LDENGIKRPNLIGIIYGEDRSRTLWLIGHMDTVPEGDLSLWEHDPYDPILKDGKIYGRGT
LDDGQAIVSSYFAAKAMRKAGMRPKYNIGLAYVADEEAGSRYGAEFLMDKGIFKPNDLVV
VPDGGAPDGSFVEIAEKSAAWIKIVTIGKQAHASMPHTGVNAHRAAMKFALAVDEYLHKK
YADEDSTFEPPISTFEITKKERNVDNINTIPGTDVIYFDFRVLPHYKIEDVIGDVRKIAE
EYEKKENVKINVEIVQASQAAPPTDVNSEIVQKLMKALRELRGIEPVAGGIGGGTVAAFF
RRVGIPAVVWMTADDVEHQPNEYCRVDNCINDAKVFIYLALS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggtgtttgaaaaacttgaaagtatgagagaagagttgatccagttcacaatt
gaaatgaacagaataaaggctgtgaaccctgcaggtggtggagagggtgaggaaaaaaga
gcagattggcttgaaaaaaaacttagggagatatgcgacgaggttgagcgctacgatacc
cttgatgaaaacggaataaagagaccaaatctgattggtataatatacggggaggataga
agcagaaccctgtggctcataggtcacatggataccgtaccagagggggacctatctctc
tgggagcatgacccctatgacccgattttgaaggacggaaagatatacgggcgcggaacc
ctcgatgatggccaggcgatagtatcttcatattttgcagcaaaggccatgcggaaggca
ggaatgagaccaaagtacaacatagggcttgcctatgttgcagatgaggaggctggaagc
agatacggggcagaatttctcatggataagggcatattcaagcccaatgaccttgttgtt
gtgccggatggaggtgctccagatggctcgtttgtggaaatcgcggagaaaagcgcggcg
tggataaaaattgttaccattggaaagcaggcccacgcatcaatgccccatacaggtgtg
aacgcacaccgggcggccatgaaatttgcccttgcggtggatgagtacctgcacaaaaag
tatgcagatgaggatagcacatttgaacctccaatctccacatttgagataaccaagaag
gagaggaatgtggataatataaacacgatacccggcacggatgtgatttactttgatttc
cgtgtgcttccccattacaaaattgaagatgttataggggatgtgaggaaaattgcggaa
gagtatgaaaagaaagagaatgtcaaaataaatgtggagatagtgcaggcatctcaggca
gcaccccctacggatgtgaacagcgaaattgtgcaaaaattgatgaaggcgcttagagaa
ctcaggggtatagagcctgttgctggaggaatcggagggggcacagtagcagcatttttc
cgcagagttggcatacccgcagttgtgtggatgaccgcagacgacgtggagcaccaacca
aacgagtactgccgcgttgataattgcataaacgatgcaaaggttttcatataccttgca
ttgagttaa

DBGET integrated database retrieval system