KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1067Help
Entry
AciM339_1067      CDS       T02396                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
acf00010  Glycolysis / Gluconeogenesis
acf00020  Citrate cycle (TCA cycle)
acf00620  Pyruvate metabolism
acf00640  Propanoate metabolism
acf00650  Butanoate metabolism
acf00680  Methane metabolism
acf00720  Carbon fixation pathways in prokaryotes
acf01100  Metabolic pathways
acf01120  Microbial metabolism in diverse environments
acf01130  Biosynthesis of antibiotics
acf01200  Carbon metabolism
Module
acf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciM339_1067
   00020 Citrate cycle (TCA cycle)
    AciM339_1067
   00620 Pyruvate metabolism
    AciM339_1067
   00640 Propanoate metabolism
    AciM339_1067
   00650 Butanoate metabolism
    AciM339_1067
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AciM339_1067
   00680 Methane metabolism
    AciM339_1067
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AciM339_1067
Enzymes [BR:acf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AciM339_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_10 Fer4_6 Fer4_7 Fer4_2 Fer4_21 Fer4_9 Fer4_16 Fer4_13 Fer4_8 Fer4_17 Fer4_15 Fer4_4 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AGB04937
UniProt: L0HJL1
Position
966689..967006
Genome map
AA seq 105 aa AA seqDB search
MEIITRGAVIPEPGNSVENKTGTWRVFKPVINYDKCIRCLICWQFCPEPAIWRHDDEETK
MNTPAPKEALKRLPVVEIDYDYCKGCGICYNECPVKAIDFVKEEK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggagataataacaagaggagccgtaattcctgaacctggaaattcggttgagaacaag
acgggaacctggagggtattcaagcccgtaataaactacgataaatgcattcggtgcctt
atatgctggcagttctgcccggagccggcgatatggaggcacgatgatgaagagacaaag
atgaacactcctgcacccaaggaagccctaaagcgactgcccgttgtggagattgactac
gattactgcaaggggtgtggaatatgctataacgaatgtcctgttaaggcaatagatttt
gtgaaggaggagaagtaa

DBGET integrated database retrieval system