KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1069Help
Entry
AciM339_1069      CDS       T02396                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AciM339_1069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciM339_1069
   00020 Citrate cycle (TCA cycle)
    AciM339_1069
   00620 Pyruvate metabolism
    AciM339_1069
   00640 Propanoate metabolism
    AciM339_1069
   00650 Butanoate metabolism
    AciM339_1069
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    AciM339_1069
   00680 Methane metabolism
    AciM339_1069
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    AciM339_1069
Enzymes [BR:acf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     AciM339_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968203..969096
Genome map
AA seq 297 aa AA seqDB search
MSYEKEEFFAPGHGMCAGCAAPIIVKWVLKYAGPNTIVVNATGCLEVATTAYPRTSWRVP
WLHVAFENAAAAASGVEAAARARGEKLNIIAFGGDGGTADIGFQALSGMVERGHNVLYVL
YDNEAYMNTGIQRSGATPWGAWTTTSKVGQANPIGKLEPKKPIARIIAAHNAKYVATANP
AIFNDFKKKVQKALSYEGPRFLHVISSCTTGWRHDPSKTIEIMKLATDTGIFPLWEVEDG
DLENMRITYKPKKFKPVEEYLKPQGRFRHLLKNPEYVKMLQEQVDAWWAKYGHHYKP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttacgaaaaggaagaatttttcgcacctggtcatggaatgtgcgctggatgcgcc
gctcccataattgtgaaatgggtactcaaatatgcaggtccaaataccatagtggttaat
gccacaggatgcttggaggtggctacaacagcatatccgcgcacatcctggcgtgtacca
tggctccatgtggcctttgaaaatgctgcggctgccgccagcggagtagaggctgcggcg
agagccagaggtgagaaactaaatataattgcctttggcggggatggtggaactgccgac
atagggttccaggctctcagcggaatggttgagagagggcacaacgtgctctacgtgctc
tatgataatgaggcgtatatgaacactggaatccagcgtagtggcgccacaccttgggga
gcatggaccaccaccagcaaggtcgggcaggcaaatcctataggcaaattggagcccaag
aaaccaattgcaagaataattgcagcacataatgccaagtacgttgcaacggcaaatcct
gcaatattcaacgattttaagaagaaggttcagaaggcactcagttacgagggtcctcgc
ttcctacatgtgatatcctcctgcacaactggatggaggcatgacccgagtaagacaata
gagataatgaaacttgcaacggatactggtatatttccactctgggaagttgaggacgga
gaccttgagaacatgcgcataacatacaagccaaagaaattcaagcctgtggaggagtac
ctcaagccccagggcaggttcaggcacctgctcaagaacccagagtacgttaagatgttg
caggaacaggttgatgcatggtgggccaagtacgggcaccactataaaccataa

DBGET integrated database retrieval system