KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1077Help
Entry
AciM339_1077      CDS       T02396                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    AciM339_1077
Enzymes [BR:acf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     AciM339_1077
Exosome [BR:acf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AciM339_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(977368..978825)
Genome map
AA seq 485 aa AA seqDB search
MPYILSLDEGTTNAKAFIISEEGKIISSASREFPQYYPRPGWVEHNPEEIWNAQILAARE
AIKKAKLEPGDVAAIGITNQRETTIIWDRNGKPVYNAIVWQCRRTAEFMERVKKEYGDLI
REKTGLIGDAYFSASKIRWILDNVQGARERAKKGELMFGTVDSYLIYKLTGKHATDYSNA
SRTMLFNIKRGQWDDELLEIFKIPEEILPEVLNSADDYGHAKEFLGNAPVSGVLGDQQAA
LFGQACFREGMLKVTYGTGNFLLINTGESVPNSRNLLSTIAWKIGNKMNYALEGSIFITG
AALKWIRDLGLIESYEETEELARSLGSNEDLYFVPAFSGLGSPYWDPYARGIIIGITRGT
RKKHIVRATLEAIAYLTRDVVEEIKRHIFVRELRVDGGASINNFLMQFQADILGVPLLRP
VNRESTSMGVAFMAGLQEDVWDMQTLEKLWEVDRKFVPKMNEAEREKLYARWKRAVSRSL
GWVID
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccatacattctttctctggacgaaggtaccacaaacgcaaaggcctttataatcagc
gaggagggaaagatcatttcctcggcaagccgtgagtttccccagtactatccacgcccg
ggatgggttgagcacaatccagaggaaatatggaacgcacagatcctcgccgccagagag
gcaataaaaaaggcaaaattggagccgggagatgttgctgcgataggcataacaaatcag
agagagacaaccataatctgggacaggaacggaaagcctgtatacaacgcaatagtgtgg
cagtgcaggagaacggcagaattcatggaaagggtgaaaaaagagtatggtgatctgata
agggagaaaaccggactcattggagatgcgtacttttcagccagtaaaataagatggatc
ctggataatgtgcaaggggctagggagcgggcaaagaagggagaacttatgttcggtact
gtggactcatatctaatttacaaactcacagggaagcacgcaacggattattccaatgca
tcgcgcaccatgctgttcaacataaaaaggggccagtgggatgatgaacttcttgaaata
tttaaaattcccgaggagattttacctgaagtattgaattctgcagatgattacggacat
gccaaggaattccttggaaacgcaccagtttctggagtgcttggagatcagcaggctgca
ctgttcggccaggcatgtttcagggagggaatgctcaaagtgacgtacggtaccggaaat
ttcctgctgatcaacacgggtgagagtgtgccaaactcaaggaacctgctcagcaccata
gcttggaaaattggaaataaaatgaactatgcacttgagggtagcatattcataacagga
gcggcccttaaatggatccgagatctgggtctcattgaatcttacgaggaaacggaagaa
cttgcaagatccctaggaagcaacgaagatctttatttcgtacccgccttttcaggtcta
ggttccccgtactgggatccatacgcaagaggtatcataataggaataactaggggaaca
agaaaaaagcacattgtacgggcaactctggaagccattgcctatctgacaagggatgtg
gttgaagagatcaaaagacacatatttgttagggaacttcgtgttgatgggggagcgagc
ataaacaacttcctcatgcagttccaggcggatattctcggcgtaccccttctcagacct
gttaacagagaaagtaccagcatgggggtggcgtttatggcaggattgcaagaggatgta
tgggatatgcaaacgcttgagaaactgtgggaggtggataggaaatttgttcccaaaatg
aatgaggcagaaagggaaaaactgtacgcaaggtggaaaagagccgtttcaaggtccctt
ggttgggtaattgattga

DBGET integrated database retrieval system