KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1144Help
Entry
AciM339_1144      CDS       T02396                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:acf01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:acf00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acf00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:acf00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1028290..1029396
Genome map
AA seq 368 aa AA seqDB search
MNLYEYQGKALFRKFGVPTPEGYVVFKPEEIGEVNRDVVIKAQVLTGGRGKSGGVKFAST
ADEARKLAEEILSMEIKGHKVHAVLVEEKLKIEKEYYLSILIDRSTRSPLIMASPEGGVE
IESVPDEKIYKYRVNPEIGVQPFVGRILSKKMGFTGDMAKQFTAILMNLYKLFREYDAEL
VEINPLVLSVGKLIAADSKVVIDSDSLYRHKDLEENAEEKTPLELEANRAGYAFVELDGN
IGVIANGAGLTMATLDTLLLYGLKPRNFLDLGGTDSVDITKNAFTYVLKANPEAILVNIF
GGVTKCDTVAQGIIAAKEEFKIDMPIVVRLSGVHEEEGRKMLADAGIHAFADMRHAIEKL
KKVMEGSE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgtacgagtatcaaggaaaggcgctgtttaggaaattcggagtgcccactccc
gagggctatgtggtattcaagcccgaggagataggggaagtgaacagggacgtggtcata
aaagctcaggtcctcacgggtggccgtggcaagagtggaggagtgaaatttgcctccacc
gcggatgaggcgagaaaacttgccgaggaaattctttctatggagatcaaggggcacaaa
gtgcatgcggtgcttgtggaagaaaaactcaaaattgaaaaggagtactacctgagcata
ctcattgacaggagcaccagatctccgctcataatggcttctcctgagggcggggtggaa
atagagagcgtgcccgatgagaagatttacaagtacagagtgaatcctgagattggggtg
cagccattcgtaggaaggattctctccaagaagatgggtttcacaggcgatatggcaaag
cagtttacggccatactcatgaacctctataaattattcagagagtatgatgctgaactt
gtggaaataaatccccttgtgctgagtgtgggtaagcttatagcggccgattccaaggta
gtaattgattctgactcgctctatcgccataaagacctggaggagaatgccgaggagaaa
actcctctggaactcgaggcaaatcgcgctggatacgccttcgttgaactggatggaaat
attggagtgatagcgaatggagcaggactaaccatggccactcttgatacactgcttctc
tacgggctcaagcccaggaacttccttgatctgggcggaactgatagtgtggatattacc
aagaatgcatttacctacgtgctaaaagccaatccagaggccattctggtgaatatattt
ggaggtgtgacaaaatgcgatactgtggcgcaggggataatagcggcaaaggaggaattc
aaaatagatatgcccattgttgtgcgccttagcggtgtgcatgaggaagagggaagaaag
atgctggctgatgcgggcattcacgcatttgctgatatgaggcatgcgattgaaaagctc
aagaaggttatggagggatcagaatga

DBGET integrated database retrieval system