KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1293Help
Entry
AciM339_1293      CDS       T02396                                 

Definition
ribulose-5-phosphate 4-epimerase-like epimerase or aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:acf00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1160541..1161107
Genome map
AA seq 188 aa AA seqDB search
MWQEIAKFGRKLVEQGLVSSHFGNISVRVGDYMYITRSGSMLDEITKDDVVRVSVYEPTS
LDLIASSEVTAHRMIYQNTSALAIIHDHSPFAVVESLIHREMGRDRIVPIDSEGSYFLHD
IPIVDGGIGTERMARNLAEALQQRKAAVVYSHGVFARGSILEDAYVVASMVEHSCKMLYY
FDMLKSHK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaatagccaaatttgggcgcaagcttgtggagcagggcctcgtgagttca
catttcggcaatataagcgtaagagttggggattatatgtacataacgcgctctggaagc
atgcttgatgagataaccaaggatgatgttgttcgtgtttctgtgtacgagcccacatcg
ctggatctcattgcatcctcggaggtcacggcccacaggatgatataccagaacacatcc
gcgcttgccataattcatgaccactctccctttgccgttgtggagtccctaatccacagg
gaaatgggaagggatagaattgtgccaatagattctgagggttcttatttcctgcatgac
ataccaatagtggatggtggcataggtactgagaggatggcaaggaatctagcggaggca
ttgcagcagagaaaggcggcggtggtgtactcccatggggtttttgcccgtggaagcata
cttgaggatgcctatgtggtagcaagtatggtggagcactcctgcaagatgctctactat
tttgatatgttgaagagccacaagtga

DBGET integrated database retrieval system