KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1396Help
Entry
AciM339_1396      CDS       T02396                                 

Definition
histone acetyltransferase, ELP3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
acf  Aciduliprofundum sp. MAR08-339
Brite
Enzymes [BR:acf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AciM339_1396
Transfer RNA biogenesis [BR:acf03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    AciM339_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1270666..1272210)
Genome map
AA seq 514 aa AA seqDB search
MDFYVEMEKAFREGKIKSKEDLERWKSRIAKKYRMPNPRNSELMRNLPEDIVREYHHILV
KKPSRTLSGVAIVAIMTSPFPCPHGKCIYCPGGPEKGTAQSYTGHEPAALRASQYNFDPY
EQTRARIEQLNAIGHPTDKIDLIIMGGTFTARPERYQEWFVKRAFDALNGVEARNLEEAH
LLNENAKNRCIGLTVETRPDWFMEKDIDFSLHLGATRVELGIQTTHDDILALVKRGHTVK
ESIISTRLAKDAGFKINYHMMPGLPGSNIERDFQAFSRIFEDPDFRPDMLKIYPTLVVKG
TELYDMWRRGEYEPYTLDEIVELLIRVIEITPPWIRIQRIQRDIPAKFIEAGVKRGDLRA
LVMREMEKRGIRCPEIRCREVGRKGGENFKLVRRDYIASQGKEIFLSFEDEERNSIASYL
RLRLPSEQAHRSEMRDAAIIREVKVFGREVPVGVREKKAWQHRGLGRRMMEEAERIAKEE
WEVGRMVVISGVGVRNYYRKLGYERLGPYMAKRL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtggatttctacgtggaaatggaaaaagcgtttcgggaagggaagataaaaagcaaagaa
gatcttgagagatggaagagcagaattgcaaagaaataccgcatgcccaatccccgcaac
tcggagttgatgagaaaccttccggaagatatcgttagggaatatcatcatattctagtt
aaaaagccctcaagaacgcttagtggcgtggccatcgttgccataatgacctctcccttt
ccatgcccgcatggcaagtgcatttattgccctggaggccctgagaagggcacggcgcag
agctacaccgggcatgagccagcagcgttgagagcatcgcaatataattttgacccctat
gagcagacaagggctaggattgagcaactcaacgcaattgggcatcccacggacaagatt
gacctcataatcatgggtggtacattcacagcccgtcctgagaggtatcaggagtggttt
gtgaaaagagcatttgatgccttgaacggagttgaggcgcgaaaccttgaggaggcacat
ctgctaaatgagaacgcgaagaacagatgtatagggctaactgtggaaacgcgtcctgac
tggttcatggagaaggatattgatttttccctgcatctcggggctacgagggttgagctt
gggatacagaccacccacgatgatatcctcgcattggtgaaaaggggtcatacggtaaaa
gagagcataatctcaacgcgcttggccaaggatgcaggtttcaagatcaactaccacatg
atgcccggactgccaggaagcaatattgagagggatttccaggcgtttagcaggattttt
gaggatccagatttcaggcccgatatgctcaaaatataccctacgctcgtggttaagggc
acagagctgtatgatatgtggaggagaggtgagtatgagccatacactcttgatgagatc
gttgagcttttgattcgcgttatagagatcacacccccctggataaggatacagagaata
cagcgagatatacctgccaagttcattgaggcaggcgtgaaacgcggagatttaagagca
ctggttatgagagagatggaaaaaaggggtataagatgcccagagatacgatgccgcgag
gtcggaaggaagggaggggagaatttcaaactcgtgagaagggactatatagcttctcag
ggcaaggagattttcctctcatttgaagatgaagagcggaattccatcgcctcatatctt
cgtttacggcttccaagtgagcaagcgcatcgttcagagatgcgagatgcggcgataatc
cgcgaggtgaaggtattcggccgcgaggtccctgtgggggttagggaaaagaaggcatgg
cagcatcggggattgggaaggagaatgatggaggaggcggagagaatcgctaaggaggaa
tgggaagttggcagaatggtggtcataagcggtgtgggtgttcgcaactattaccgcaaa
ctcgggtacgagcgtctcggcccgtacatggcgaagcgtctatga

DBGET integrated database retrieval system