KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1448Help
Entry
AciM339_1448      CDS       T02396                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:acf00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:acf00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1319573..1320487)
Genome map
AA seq 304 aa AA seqDB search
MFKGRDIVSIKELSREDMERIFEVAREMVPIARGERNSDLLQGKILATLFFEPSTRTRLS
FESAMHRLGGSVIGFSNPSATSISKGETLADTVRVMDSYSDVIVIRHPYEGSARLAAEFA
ENPVINAGDGAGQHPTQTLLDLFTMYQEFGDIRGLKIALIGDLKYGRTVHSLAYALSKLG
ADIYLVSPELLKMPRHIIRELQKKPVETDKIEDVMEEIDVFYVTRIQKERFPDPTEYKRV
AGSYSITAELLKRAKKESIVMHPLPRVNEIAPDVDSTPHARYFQQAFNGVPVRMALLALV
LGVV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagggtagagatatcgtctcgataaaggaactctccagggaggatatggagaga
atttttgaggttgccagagagatggtgcccattgcaaggggggagagaaatagtgatctt
cttcaggggaagattcttgccacgttgttctttgagccgtctacccgaacaagattgtcc
tttgaatcggccatgcatcggcttggagggtccgttataggattcagcaatccctctgcc
acatccatatccaagggagagaccttagcggatactgtgcgggtaatggattcctacagt
gatgttattgtgatcagacatccttatgagggctcggccagacttgcggcggaatttgca
gagaatccagttataaatgcaggtgatggagctgggcagcatccgacccagacgctactg
gacctttttacaatgtatcaggaatttggagatatacggggattaaagatagcgctcata
ggggatttgaaatacgggagaactgtccattccctagcctatgcgttgagcaaattgggt
gctgatatttatctcgtatcaccagaacttctgaaaatgcccaggcacataataagggaa
ctgcaaaagaaacctgtggagacggataaaatagaggatgtgatggaggaaattgatgta
ttttacgtcacccgaattcagaaagagcgttttccagatcccacggaatacaagagggtt
gcaggttcctattccattacggcagaattgcttaagagggcgaaaaaagaatcaatagtt
atgcatccactcccacgtgtcaatgaaattgctcccgatgttgattccactccccatgcc
agatattttcagcaggcgtttaatggtgtacccgttagaatggccctactggccctcgtt
ctgggggtggtataa

DBGET integrated database retrieval system