KEGG   Aciduliprofundum sp. MAR08-339: AciM339_1571Help
Entry
AciM339_1571      CDS       T02396                                 

Definition
phosphoglucosamine mutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
acf  Aciduliprofundum sp. MAR08-339
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:acf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AciM339_1571
   00030 Pentose phosphate pathway
    AciM339_1571
   00051 Fructose and mannose metabolism
    AciM339_1571
   00052 Galactose metabolism
    AciM339_1571
   00500 Starch and sucrose metabolism
    AciM339_1571
   00520 Amino sugar and nucleotide sugar metabolism
    AciM339_1571
  Nucleotide metabolism
   00230 Purine metabolism
    AciM339_1571
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    AciM339_1571
Enzymes [BR:acf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     AciM339_1571
    5.4.2.8  phosphomannomutase
     AciM339_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1423954..1425306
Genome map
AA seq 450 aa AA seqDB search
MRLFGTNGIRGRVGEDFTPEFLTKIGLAIGSYLPRSANVILGTDTRISGDMVKFAVISGL
LASGVNVVDIEIAPTPAIQLYTREHGDFGIAITASHNPPEFNGVKCIAGDGTELPREEEE
RIEKIFFSEKFRIVNWEDVGDYTKGGNAREEYIRSILQRIDVESIKNKNFKVVLDCANGA
SCFTSPYLLETLGCKVITLNCQPDGRFPGHESEPKPENLRNLVSMVKATGADLGIAHDGD
ADRAIFVDDRGRYLYGDKTLTLVAEYVVRNKSGIVVTPVSSSLSLEEVVKKHGSRVLYTK
VGAPIVARKMIEVKAIFGGEENGGLIFPEHLVARDGAMALAKVLEILAKSGKKLSQLIDS
LPQYYQKKISVRCANEKKERALDILKEKLKGERINTIDGVKIMGESWWVLIRPSGTEPIY
RIYAEAKSEEELNTIVERYKKILEDAVREA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctatttggcaccaatggaattcgcggaagggtgggtgaggatttcaccccagaa
tttttgacaaagatagggctggcaataggctcgtaccttccaaggagtgcgaatgtgata
ctcggcacagatacgaggatatctggagatatggttaaattcgccgtaatctcggggctc
cttgcctccggagttaacgttgtggacattgaaattgcacccactcctgccatacaactc
tacacgagagagcatggagattttggaatcgccataactgcaagccacaaccccccagag
ttcaacggggtaaaatgcattgcgggagatggcacagaactgccacgcgaggaggaggag
aggattgagaaaatattcttctcggaaaaattcaggattgtgaattgggaggatgtggga
gattatacaaagggaggaaatgcaagggaagagtacatacgctccatacttcaaaggatt
gacgtggagagcataaaaaataaaaatttcaaggtggtgctcgattgtgccaacggagca
tcctgtttcacatccccatatctcctggaaacattgggatgtaaggtaataaccctaaac
tgccagccagatggcagatttccaggtcacgaaagcgagccaaaacctgagaatctcagg
aacctcgtgtccatggtaaaggccacaggcgcagatctgggtatagcccacgacggagat
gctgaccgggcgattttcgttgatgataggggcaggtatctatacggggacaaaacactc
acccttgttgcagaatacgtagtaaggaataaaagcggaattgttgttacgcctgtgagt
tcgtccctatctcttgaggaggtcgtgaaaaaacacgggagcagggtgctgtacaccaag
gtgggtgcaccgattgtggcaagaaaaatgattgaggtaaaggccatttttggtggcgag
gagaacggtgggctcatatttccagagcatttggttgcgagggacggtgccatggctctg
gcaaaggtgcttgaaattctggcgaagagcggaaagaaactgagtcagttgattgattcc
ctgccacaatattatcagaaaaaaataagcgtgagatgcgccaacgagaaaaaagagagg
gcccttgatattctcaaagaaaaattgaaaggagagagaataaacacgatagacggagtg
aagataatgggggagagttggtgggtgctcatacgtccatcgggcacagaacccatctac
aggatatacgcagaagcaaagagtgaggaagaacttaacactattgtggaaagatacaaa
aaaattctggaggatgccgtgagagaggcatga

DBGET integrated database retrieval system