KEGG   Pseudarthrobacter chlorophenolicus: Achl_0140Help
Entry
Achl_0140         CDS       T00834                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Achl_0140
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_0140
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achl_0140
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Achl_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
152641..153942
Genome map
AA seq 433 aa AA seqDB search
MNVALGDPGMAPADEPQPGQSSFRNAPGPYFGSFGGRWMPEALIAALDELENTFREAKVD
PEFATQIADLNRNYTGRPSPLTEATNFARHAGGVRVFLKREDLNHTGSHKINNVLGQALL
AKRMGKSRVIAETGAGQHGVASATAAALLDLDCVVYMGAEDCRRQALNVARMKLLGATVV
PVATGSKTLKDAINEALRDWVANVDTTHYMLGTAAGAHPFPAMVRYFHQVIGDEARSQVL
ERTGRLPDAVCACIGGGSNAIGIFHAFLDDPSVAIHGFEAGGEGIETGRHAAPITLGLPG
VLHGAKSYLMQDDDGQTIESHSISAGLDYPSVGPEHAYLADIGRVSYEPITDREAMDAFG
LLCRTEGIIPAIESAHALAGALKVGQRMATADTATGDSNKRIVIVNLSGRGDKDVGTAAE
WFDLLGPESVVVS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttgcattaggtgaccccggcatggcaccggcggatgaaccgcagccgggccag
tcctcattccgaaatgcccccggtccatatttcggctcctttggcggacgctggatgccg
gaggcacttatcgcagctcttgacgagcttgagaacacgttccgcgaggctaaagtcgat
cccgagttcgcgacgcaaatcgcggacctgaaccggaactacaccggccggccctcgcca
ttgaccgaggccacgaactttgcccggcatgcgggtggcgtccgagtattccttaaacgc
gaagacctcaatcacacgggctcccacaagatcaataacgtgctcggccaggcgctcctc
gccaaacgcatgggcaagtcccgggtcatcgccgaaacaggcgccggccagcatggagtc
gccagtgctacggcagcggccctgctcgacctcgattgcgtcgtgtacatgggtgccgag
gactgtcgccgtcaagctctaaatgtggcaaggatgaagctgcttggcgcaaccgttgta
ccagtggctaccggctccaaaaccctgaaggacgccatcaatgaagctcttcgtgactgg
gtggccaacgttgatacgacccactacatgctgggcaccgcggcaggagcccatccattt
ccagctatggtccggtacttccaccaggttatcggcgacgaggcccgcagtcaggtactg
gaacgtaccggccgcctcccggatgccgtttgcgcctgcatcggcgggggatctaacgcc
atcggcattttccatgctttcctggatgacccgtcggtagcaatccacgggttcgaggcc
ggcggcgagggcatcgagaccggcaggcacgcggccccgatcactcttggcttgcccggt
gtgttgcacggggccaagtcgtacctaatgcaggacgacgacggccagaccatcgaatcc
cattcgatttccgcgggtcttgactacccaagcgtcggaccggaacacgcctatctggca
gacatcggtcgcgtcagctacgagccgatcaccgaccgggaagccatggacgcattcggt
ctcctgtgccgtaccgagggcatcattcccgcgattgagtcggcccacgcactcgccggc
gccctcaaggtagggcaaagaatggccacagcggacactgcgactggtgattcaaacaag
aggatagtgattgtgaatctatccggcaggggcgacaaagacgtagggactgccgccgag
tggtttgaccttttaggccccgagtccgtcgtggtctcctga

DBGET integrated database retrieval system