KEGG   Arthrobacter chlorophenolicus: Achl_0187Help
Entry
Achl_0187         CDS       T00834                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Achl_0187
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Achl_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
212065..213048
Genome map
AA seq 327 aa AA seqDB search
MSTAAGPADSTGTGRIVVVGSLNADLTIYCERLPQPGETVHGNGFAVNPGGKSANQAVAA
GRLGGRVSLVGAVGDDPNGHMLLSSVAGAGVDVGLVRSSSEPTGVAVISVDAAGENNIII
SAGANGTLSPADVAGAADVLDGAAVVSLCLEVAMPTVLAAAQAGHDAGAKVLLNLSPYAH
IPRELAGLVDVLLVNAHEAALFLGPGASVPGADAHAAQWDAVRERFAERGIRQVLVTLGA
HGSVVLDSDAPAGRAVVFVAPTKVDAVDTTGAGDAFTGAVAVRLAAGDALADAAAFASVA
AALATTRKGTQAAYPETADVERRLRKS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagcagccgggccggccgattcgacgggcaccggccggatcgtcgtcgtcggc
tccctcaacgccgacctcaccatctactgcgaacggctcccgcagccgggcgaaacggtg
cacggcaatggcttcgccgtgaacccgggcggcaagagcgccaaccaggccgtcgccgcc
ggccggctgggcgggcgggtcagcctggtgggtgccgtgggggatgaccccaacgggcac
atgctgctgtcctcggtggccggtgccggcgtggacgtggggctggtgcgcagctccagc
gagcccaccggcgtcgccgtcatctccgttgacgcggccggcgaaaacaacatcatcatc
tccgcaggcgccaacggcacactgtccccggcggacgtggcgggagccgcggacgtcctg
gacggcgccgccgtcgtcagtctctgcctggaagttgccatgcccacggtcctggccgca
gcgcaggcggggcacgacgccggcgcgaaagtcctgctgaacctctcgccgtacgcgcac
attccgcgagagctggccgggttggtggacgtcctgctggtgaacgcccatgaagcggcg
ctgttcctcggccccggggcatccgtcccgggtgccgacgcccacgccgcgcaatgggat
gccgtccgcgaacgcttcgctgaacgggggatccggcaggtcctggtaaccctcggtgcc
catggttccgtggtgctcgattccgacgctcccgccggccgcgccgtggtgttcgtagca
cccaccaaagtggacgccgtggacaccaccggtgccggcgacgccttcaccggtgccgtg
gccgtacgcctcgcggccggcgatgcgctagccgacgccgcagcattcgcctccgtggcc
gcggccctggccaccacccgcaaggggacgcaggcggcgtacccggagacggccgacgtc
gaacggcgcctgcgcaagtcctga

DBGET integrated database retrieval system