KEGG   Arthrobacter chlorophenolicus: Achl_0303Help
Entry
Achl_0303         CDS       T00834                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Achl_0303
Enzymes [BR:ach01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Achl_0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
321712..324174
Genome map
AA seq 820 aa AA seqDB search
MTGSTGNDVKGNGNAGQATAEQGTLGRGELELVDRWWRAANYLSVGQIYLRSNPLLREPL
KPEDTKSRLLGHWGTTPGLNFVYAHLNRVIRRDAAEMLFIAGPGHGGPAVVANAWLEGTY
SEIYGHVGNDEAGLAELFRQFSYPGGIPSHAAPESPGSISEGGELGYSLAHAYGSVLDNP
QLVTAVVIGDGEAETGPLAASWHSHNFLDPAADGAVLPILHLNGYKIANPTVLARMPQEQ
LEQLLRGYGHEPYFVTVQDPGKTGQAHQDFAGVLDQCLADIRAIQAEHRGAGDVHNGAGD
GTSGDHPGHRWPMIVLRSPKGWTGPRTVDGLQVEGTWRAHQVPLSEVRTNGEHLKQLEEW
LQSYRPEELFDGDGRLRAAVAEAAPTGDFRMSATPHANGGVLRRALKLPPYRDYAVEVEA
AGTERVSPMITLGSWIRDVIAQNMENFRLFGPDETASNRLQNVYEVTDKVWQYRIDDADE
HLARSGRVMEVLSEHLCQGWLEGYLLTGRHGVFNCYEAFIHIVDSMFNQHAKWLKVHRRL
PWRQPVPSLNYLLSSHVWQQDHNGFSHQDPGFIDHAVNKKAEVIRVYLPPDANTLLSVME
HCLASTDCVNVVVSGKQPSPTWLGPADAANHCRRGLGIWTFAGSEVAGGEPDVVLACAGD
VPTVETVAAAELLRNGVPGLKVRVVNVVDLMRLQDESEHPHGLPGRDFDGIFTTDKPIIF
AYHGYPALIHRLAYKRTNQEGLHVHGYQEEGTTTTPFDMAMLNGIDRFTLAIDAIDRVPG
LAEKYSLLRQELQDRRDSAREHTRTHGEDPEEIRNWKLGG
NT seq 2463 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagcactgggaatgacgtcaagggaaacggcaacgcggggcaggcgaccgct
gaacagggcaccctgggacgcggggaactcgagctcgtggaccgctggtggcgcgccgcc
aactacctgtccgtcggccagatctacctgcgctccaacccgctgctgcgcgaaccactg
aagccggaggacaccaagtcccgcctgttgggccactggggcaccactcccgggcttaac
ttcgtgtacgcccacctgaaccgcgtcatccgccgcgacgctgccgagatgctctttatt
gccggtcccggccatggcggccccgccgtcgtcgccaacgcctggctggagggaacgtat
tcggagatctacggccacgtgggcaacgacgaagccgggctcgcggaactcttccgccag
ttctcctaccccggcggcatccccagccacgcggcgccggagagcccggggtccatcagc
gagggcggcgaactcggctattccctggcccacgcctacggctcggtgctggacaacccg
cagctggtgaccgccgtcgtgatcggcgacggcgaggctgaaaccgggccgctggcagcc
agctggcactcgcacaatttcctggacccggcggcggacggcgccgtgttgcctatcctg
cacctcaacggctacaagatcgccaaccccacggtgctcgcccggatgccccaggaacag
ttggagcagttgctgcgcggctacgggcacgaaccgtacttcgtcacggtgcaggatccg
ggcaagaccggtcaggcgcaccaggatttcgccggtgtcctggaccaatgcctcgcggac
atccgcgccatccaggctgaacaccgcggcgccggagacgtccacaacggggccggggac
ggcacctccggagaccacccgggacaccgctggcctatgatcgtcctgcgttcgccgaag
ggctggaccggtccgcggaccgtggacgggctgcaggtggaagggacctggcgcgcccac
caggtcccgctgtccgaggtccgcaccaacggcgaacaccttaaacagctggaggagtgg
ctgcagtcctaccgtccggaagaactgttcgacggcgacgggcggctccgtgcggccgtc
gccgaggcggccccaacaggggacttccggatgagtgccaccccgcatgccaacggcgga
gtgctgcggcgcgccctgaagctgcctccctaccgggactacgccgtcgaggtggaagca
gcaggaactgagcgagtgagccccatgatcacgctgggctcgtggatccgggacgtgatc
gcgcagaacatggagaacttccgcctgttcgggccggatgaaaccgcatcgaaccggctg
cagaacgtctatgaggtcaccgacaaggtgtggcagtaccggattgacgacgccgacgag
caccttgccaggtccggccgcgtcatggaggtcctcagcgagcacctgtgccagggctgg
ctggaaggctacctgctcaccggcaggcatggagtcttcaactgctacgaggccttcatc
cacattgtcgactcgatgttcaaccagcatgccaagtggctgaaggtgcaccgcaggctg
ccgtggcgccagccggtgccctcgctgaactacctgctgtcctcgcatgtctggcagcag
gaccacaacggcttctcgcaccaggacccggggttcatcgaccacgcggtgaacaagaag
gctgaggtcatccgggtgtacctgccgccggacgccaacaccctgctgtccgtcatggag
cactgcctggcgtccacggactgcgtgaacgtagtggtcagcggcaagcagccctcgccc
acctggttgggcccggcggacgcggccaaccactgccgccgcggcctggggatctggacg
ttcgccggctccgaggtggcgggcggggagcccgacgtcgtgctggcctgcgcgggcgac
gtccccaccgtggagaccgtggccgccgcggaacttctgcgaaacggggtcccggggctg
aaggtccgcgtggtcaacgtggtggacctgatgcgcctgcaggacgagagtgaacacccg
cacgggttgccgggcagggacttcgacggcatcttcaccactgacaagcccatcattttc
gcgtaccacggctaccccgcgctgatccaccgcctggcgtacaagcgcaccaaccaggag
ggcctgcacgtgcacggctaccaggaggaggggacaaccaccaccccgttcgacatggcc
atgctcaacggcatcgaccgcttcacgctcgccatcgacgcgatcgaccgggtgccaggc
ctggccgagaagtactcactcctgcggcaggaactgcaggaccgccgcgacagcgcccgc
gaacacacccgcacgcacggcgaggacccggaggagatccgcaactggaaactgggcggc
tga

DBGET integrated database retrieval system