KEGG   Pseudarthrobacter chlorophenolicus: Achl_0315Help
Entry
Achl_0315         CDS       T00834                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00790  Folate biosynthesis
ach01100  Metabolic pathways
Module
ach_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Achl_0315
Enzymes [BR:ach01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Achl_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ACL38315
JGI: Achl0315
UniProt: B8H9T1
Position
335669..336313
Genome map
AA seq 214 aa AA seqDB search
MTSFDDDAVSASAAYPAEDGSAHAPHHKVDRPRIEAAVREILLAIGEDPDRGGLIDTPKR
VAKAYAEVFAGLHQDPADVLSTTFELDHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIP
SHDGRVTGLSKLARLVDIYARRPQVQERLTTEIVEALVRHLKPRGAIVVVECEHMCMSMR
GIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccttcgacgacgacgccgtttccgcctccgccgcctacccggcggaggacggc
tccgcccatgccccgcaccacaaggtggaccggccaaggattgaagcggctgtccgcgag
atcctcctggccatcggcgaggacccggaccgtggcggactcatcgacacccccaagcgg
gtggcgaaggcgtacgccgaggtttttgcgggactgcaccaggaccccgcggacgtcctg
tccaccacattcgaactggaccatgaagaactggtcctggtgaaggacatccccttctac
tccacctgcgagcaccatctggtgccgttccacggtgtggcccacgtcggctacattccc
tcccatgacgggagggtcaccgggctgagcaagctggcccggctcgtggacatctacgcc
cgccgcccccaggttcaggagcggctcaccacggagatcgtcgaagcgctggtccgccat
ctcaagccgcgtggcgccatcgtcgttgtcgaatgcgagcacatgtgcatgtcaatgcgc
ggtatccgcaagcccggagcaaagaccgtcaccagtgcggtccgcgggcagcttcatgac
ccggccacccgtgccgaagccatgagcctcatcctcggaaggtaa

DBGET integrated database retrieval system