KEGG   Arthrobacter chlorophenolicus: Achl_0315Help
Entry
Achl_0315         CDS       T00834                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Achl_0315
Enzymes [BR:ach01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Achl_0315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
335669..336313
Genome map
AA seq 214 aa AA seqDB search
MTSFDDDAVSASAAYPAEDGSAHAPHHKVDRPRIEAAVREILLAIGEDPDRGGLIDTPKR
VAKAYAEVFAGLHQDPADVLSTTFELDHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIP
SHDGRVTGLSKLARLVDIYARRPQVQERLTTEIVEALVRHLKPRGAIVVVECEHMCMSMR
GIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgacttccttcgacgacgacgccgtttccgcctccgccgcctacccggcggaggacggc
tccgcccatgccccgcaccacaaggtggaccggccaaggattgaagcggctgtccgcgag
atcctcctggccatcggcgaggacccggaccgtggcggactcatcgacacccccaagcgg
gtggcgaaggcgtacgccgaggtttttgcgggactgcaccaggaccccgcggacgtcctg
tccaccacattcgaactggaccatgaagaactggtcctggtgaaggacatccccttctac
tccacctgcgagcaccatctggtgccgttccacggtgtggcccacgtcggctacattccc
tcccatgacgggagggtcaccgggctgagcaagctggcccggctcgtggacatctacgcc
cgccgcccccaggttcaggagcggctcaccacggagatcgtcgaagcgctggtccgccat
ctcaagccgcgtggcgccatcgtcgttgtcgaatgcgagcacatgtgcatgtcaatgcgc
ggtatccgcaagcccggagcaaagaccgtcaccagtgcggtccgcgggcagcttcatgac
ccggccacccgtgccgaagccatgagcctcatcctcggaaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system