KEGG   Arthrobacter chlorophenolicus: Achl_0316Help
Entry
Achl_0316         CDS       T00834                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Achl_0316
Enzymes [BR:ach01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Achl_0316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
336326..337246
Genome map
AA seq 306 aa AA seqDB search
MDSLAAAPGTGPATSPLPILRKPRPAARFEDLPTDRTLVMGILNVTPDSFSDGGKHATAD
TAIAAGLRMFYAGADIIDVGGESTRPGADDVSPDEEQKRVIPVIEALVKAGALVSIDTTH
AVTAAAALKAGAAIINDVSGLTIEPEMAELVASSKAPYILTHRRGDARTMNSLAEYTDVA
GEVVAELAGVRDKLYAAGVSAEQIIVDPGLGFAKNDAHNWELLQNLEQLEALGHRVLVAA
SRKRFLGTLLTVAGKSAAPEERDGATAAITAISASRGAWAVRVHDVGSSLDAVKVAARMA
AVPKAP
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggactcactagctgcagccccgggaaccgggcccgcaacctcgccgctgcccatcctg
cgcaaaccgcgcccggccgcccgctttgaggacctgcccacggaccgcaccctggtcatg
ggcatcctcaacgtcacccccgattcgttcagcgacggcggcaagcacgccacggcggac
accgccatcgccgcgggcctgcgcatgttctacgccggtgcggacatcatcgacgtcggg
ggcgagtcgacgcgccccggcgctgatgacgtctccccggacgaggagcagaagcgtgtc
atccccgttatcgaagccctggtcaaggccggtgccctggtcagcattgacaccacccac
gccgtcaccgcagctgctgccctgaaggctggcgccgccatcatcaacgacgtttccggg
ctgaccatcgaacccgaaatggccgaactcgtggcctcgtccaaggcgccgtacatcctt
acccaccgccgcggcgatgcccgcaccatgaactccctcgcggagtacacggacgtggcc
ggcgaagtggtggcagaactggccggagtgcgggacaaactgtacgccgcaggcgtcagc
gctgagcagatcatcgtggaccccggcctgggctttgcgaagaacgacgcccacaactgg
gagctgctgcagaacctggagcagctggaggccctgggccaccgcgtcctggtggcggca
tcccgcaagaggttccttggcaccctcctgacggttgccggcaaatccgctgctccggaa
gagcgggacggagcaaccgcggccatcacggccatcagtgcctcccgcggcgcctgggcc
gtccgggtgcacgacgtcggatccagccttgacgccgtcaaggtcgccgcgcgcatggcg
gcagtacccaaagcaccgtaa

DBGET integrated database retrieval system