KEGG   Arthrobacter chlorophenolicus: Achl_0318Help
Entry
Achl_0318         CDS       T00834                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Achl_0318
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Achl_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
337665..338210
Genome map
AA seq 181 aa AA seqDB search
MNAVYTKAVLALGSNLGERNDTLSGAVADLVDPPEVRLLAVSPIIQTKAVGGPPGQPDFL
NMVLTVETSLAPHELLEHCQAVENKHHRVREVRWGPRTLDVDIITYGDVRSDDPVLTLPH
PRAAGRAFVLYPWSLIDPAATLEGERISTLAARAADYGDLAPFDGFGDFDGMPTAGAVTD
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcggtctacaccaaggcggtcctggccctgggaagcaacctcggcgaacgcaac
gacaccctgtccggcgcggtagctgaccttgttgacccgccggaggtgcgcctccttgcg
gtgtccccgatcatccagaccaaagccgtgggcggtccgcccgggcaacctgacttcctg
aacatggtcctcaccgttgaaaccagcctggctccccatgagctgctggagcattgccag
gcggtggagaacaagcaccaccgggtccgcgaggtgcgctgggggccccgcacgctcgac
gtcgacatcatcacctacggcgacgtgcgcagcgacgaccccgtactgaccctgccgcac
ccgcgcgccgccggcagggctttcgtgctgtacccgtggtccctgatcgaccccgccgcc
acccttgagggggagcgcatcagtaccctcgccgcccgggcggcggactacggcgacctt
gccccgttcgatggtttcggcgactttgacgggatgccgaccgccggggcggtgacagac
cgttga

DBGET integrated database retrieval system