KEGG   Arthrobacter chlorophenolicus: Achl_0478Help
Entry
Achl_0478         CDS       T00834                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Achl_0478
Enzymes [BR:ach01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Achl_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
508437..510629
Genome map
AA seq 730 aa AA seqDB search
MTASDQQHVLRRNAPAELPAVDAHLLQQLADAHGVGTSFQGWDGLPHAVSLETLTKVLGA
LGVPAHTEEQIRAGLAEAELAPWRKTLPPAVVIQQGEPAQVPVHIPDGAAVSLRISLEGG
AGSVEAAQQDVWVQPRDVDGVAMGRATFALPPDLPLGWHTLHAEAGSVTATATLVVTPAR
LDTARDLEERRGWGLATQLYSVRSKRSWGIGDFADLADLAAISGARGADYVLVNPLHAAE
PVPPVQPSPYSPSTRRFFNPIYIRIEAVPELAYLRPRKRAALEKLREEVAGLNRDAERLD
RDAVYAAKLQALELLYHTRRSPSRQAAFDEFCRISGSGLDDFALWSAIREDAAPDDPMWT
DPAFSLDSQEAQALRARLEDRIGFHRWLQWICDEQLENAQQAALRSGMRLGVVHDLAVGV
DHSSADAWTLKGVLTPGTSVGAPPDMYNQQGQDWGQPPWHPSRLAEAGYQPFRNMLATVL
RHAGGIRVDHILGLFRLWWIPSGNAPGDGAYVKYDHEALIGILALEAHRAGAVVIGEDLG
TFEPWVRDYLAARGILGTSILWFEYDGDSPLAPEKYRTQALSSVNTHDLPPTAGYLAGDH
VALRSYLGLLERSEAEERAQHNASLEKMFALLRERGYLTGSGSGGDAEEQTIEALHLLLS
QTPSVLLGVALVDAVGERRVQNQPGTTEALYPNWQVPLAGPDGKPVFLDDLPANARFNSL
LAAVEEALHG
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgacggcatcagaccagcagcacgtattacggcggaacgcgcccgcggaactaccggcc
gtggatgcgcacctgctgcagcagctcgcggacgcccatggggtgggcacttccttccag
ggctgggacgggctgccgcacgcggtgtccctggagaccctgacgaaggtcctgggcgcg
ttgggcgtgccggcccacaccgaggaacagatccgggcggggctggccgaagcggaactg
gctccctggcgcaaaacgctgcctcccgccgtcgtcatccaacagggcgagccggcccag
gtaccggtgcatattcccgacggtgccgcggtgagcctccgcatcagccttgaaggcgga
gcggggagcgtggaggcagcccagcaggacgtgtgggtgcagccgcgggacgtggacggc
gtggccatgggccgggccactttcgccctgccgccggacctgccgctcggctggcacacg
ctgcacgcggaggccggaagtgtcaccgccacagcaacactggtggtgacgccggcgcgg
ctggataccgccagggaccttgaggagcggcgcggctgggggctcgccacccagctgtac
tccgtgcgttcgaagcgttcgtgggggatcggagatttcgccgaccttgccgacctcgca
gcgatcagtggagcccgcggcgccgattacgtcctcgtcaaccccctgcacgctgcagag
cccgttccaccggtgcagccctcaccgtactcgccgtccacccggcggttcttcaacccg
atctatatccggatcgaggcggttccggagcttgcctacctgcggccccggaagcgggct
gcgctggagaagctgcgcgaggaagtggcagggctcaacagggatgccgaacggctggac
cgggacgccgtctacgcagcgaaactgcaggcgctggaactgctgtaccacacgcgccgg
tcgccgtcccggcaggcggccttcgatgagttctgccgcatttccggcagcggcctggac
gacttcgccctctggtcagccatccgcgaggacgcagccccggacgatcccatgtggact
gacccggcgttctcgctggattcgcaggaggcgcaggcgctgcgggcaaggctcgaggat
cggatcggcttccaccggtggctgcagtggatctgcgacgagcagctggagaacgcgcag
caggcagcgctgcgttctgggatgcggctgggcgtggtgcacgacctcgcagtcggcgtg
gaccacagcagcgctgacgcttggacgctgaagggcgtgctcacccccggcaccagcgtt
ggcgcgccgccggacatgtacaaccagcagggccaggactggggccagccgccgtggcac
ccttcgcggctggccgaagcgggctaccagccgttccgcaacatgctggccaccgtgctg
cgtcacgccggcggcatccgggtggaccacatcctgggacttttccggctgtggtggatc
cccagcggcaacgcccccggcgacggcgcctacgtgaagtacgaccatgaggcactgatc
ggcatcctggcactggaagcgcaccgggcgggtgcagtggtgatcggtgaggacctgggc
accttcgaaccgtgggtgcgggactaccttgccgcgcgcggcatcctgggcacgtccatt
ctttggttcgagtacgacggcgattcgccccttgcgcccgaaaagtaccggacgcaggct
ctttccagcgtcaacacccacgatcttccgcccaccgccggttacctcgccggagaccac
gtagcgttacggagctacctggggctgctggaacggtccgaggccgaagagcgtgcccaa
cacaacgcgtccctggaaaaaatgttcgcgctgctccgcgaacgcggctacctgaccgga
tccggctccggcggtgacgcggaggagcagaccatcgaggccctgcacctgctgctgagc
cagacgccgtccgtgctgttgggcgtggcgctggtggatgcggtgggggagcggcgggtg
cagaaccagcccggaaccacagaggcgctctaccccaactggcaggtgcccctggccggc
ccggacggcaagccggtgttccttgatgacctccccgcgaacgcgcggttcaactcgctg
ctcgcggcggtggaggaggccctgcacggctag

DBGET integrated database retrieval system