KEGG   Arthrobacter chlorophenolicus: Achl_0578Help
Entry
Achl_0578         CDS       T00834                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ach00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:ach00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
619945..620694
Genome map
AA seq 249 aa AA seqDB search
MEHELNGRKALVTGGAGGIGAACVRELAARGAKVVVADVDAAAAAALADEVGGTSWAVDL
LDVDSLGTLSLDCDILVNNAGIQRISPIEEFDPVQFRRILALMLEAPFLLVRAALPHMYA
NKFGRIINLSSVHGLRASPFKSAYVSAKHGLEGLSKVTALEGGEHGVTSNCVNPGYVRTP
LVEKQIADQAAVHGIPESEVLAKVMLTEAAVKRLVEPEEVASLVAWLASDHAGMVTGASY
TMDGGWSAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggaacacgaactgaatggccggaaggccctggtcaccggcggagccggcggcatcggg
gcggcctgtgtccgggaactggccgcccgcggggcgaaagtggtggtggccgacgtcgac
gcggcagcggctgccgccctcgccgacgaagtgggcggcacatcctgggccgtggacctg
ctggacgtggactcgctcggcaccctgagcctggactgcgacatcctggtcaacaacgcc
gggatccagcggatcagccccatcgaggagttcgatccggtgcagttccgccggatcctg
gccctcatgcttgaggcgccgttcctcctggtccgtgcagccctgccgcacatgtacgcc
aacaagttcggccgcatcatcaacctgtcctcggtgcacgggctccgcgcctccccgttc
aagagcgcctacgtatccgccaagcacggcctggaagggctcagcaaggtgacggcgctc
gagggcggggaacacggtgtgacgtccaactgcgtgaaccccggctacgtccggacgccg
ctggtggagaagcagatcgcggaccaggcagcagttcacggcatccccgaatccgaggtc
ctggccaaggtgatgctcacggaggcggccgtcaaacgcctggtggagccggaggaagta
gcgtccctggtggcctggcttgcttcggaccacgccggcatggtgaccggtgccagttac
accatggacggcggctggtccgcaaagtaa

DBGET integrated database retrieval system