KEGG   Arthrobacter chlorophenolicus: Achl_0631Help
Entry
Achl_0631         CDS       T00834                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Achl_0631
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Achl_0631
   00650 Butanoate metabolism
    Achl_0631
  Lipid metabolism
   00071 Fatty acid degradation
    Achl_0631
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Achl_0631
   00310 Lysine degradation
    Achl_0631
   00360 Phenylalanine metabolism
    Achl_0631
   00380 Tryptophan metabolism
    Achl_0631
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Achl_0631
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Achl_0631
   00281 Geraniol degradation
    Achl_0631
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Achl_0631
   00627 Aminobenzoate degradation
    Achl_0631
   00930 Caprolactam degradation
    Achl_0631
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Achl_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
677920..678999
Genome map
AA seq 359 aa AA seqDB search
MTETAATPEAEVLFTRRGRLAVATLNRPKAVNALTAGMVDALLRQLTEWAEDGSVGTVLV
QGAGGRGLCAGGDIVAIYRDILRGGDDTADFWQAEYRLNYLISRYPKPYVALMDGLVLGG
GVGISAHGSVRVVTERTRTGMPETTIGFAPDVGGTLLLAGAPGEAGTHAALTGAHLDGAD
ALFLGLADRYVPSGRLDELTAALENETPEDAVGRFAADPPPSGLAGQRQWIDSCYDSADA
EAIVGRLRAWAGDGSAEASHAADTIEAKSPISVKVTLASLRRVAGMPLDRALAQEYRVGL
RFLAAPDFREGIRAQVVDKDRTPHWKPPTLAEVSPEQVERFLDRWAAANWTSEPVRSMG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaacggccgccacacctgaagcggaagtgctcttcacccggcgcggccggctg
gcggtggcaacgctcaaccggcccaaagccgtcaacgcgctcactgccgggatggtggac
gcattgctgcggcagctcaccgaatgggctgaggacggcagcgtcggcaccgtcctggtg
cagggcgctggcgggcgggggttgtgcgccgggggagacatcgtggcgatttaccgcgac
atcctccggggcggagacgacactgcggatttctggcaggccgagtaccggctgaactac
ctgatctcccggtacccgaaaccttacgtggcactgatggacggccttgtgctgggcggc
ggcgtgggaatctcggcgcacggctcggtccgcgtagtcaccgagcggaccaggaccggc
atgccggagacaaccattggatttgcgcccgacgtcggcgggacgcttctgctggccggc
gcaccaggggaggcgggaacccatgcagccctcaccggcgcccacctcgacggcgcggac
gcgctgttccttggcctggcggaccgctacgtcccgtccggcaggctcgacgaactcacg
gcggcgctggaaaacgaaaccccggaagacgccgtcggacgctttgccgcggacccgccg
ccgtccggacttgccgggcaacggcagtggatcgacagctgctacgactctgcggacgcg
gaagcgatcgtggggcggctgcgggcctgggccggggacggaagcgctgaagcgtcccac
gccgcggacaccatcgaggcgaagtcccccatctccgtcaaagtcaccctggcgtcgctg
cggcgcgtggcgggaatgccgctggaccgggcgctggcgcaggagtaccgggtgggcctg
cggttcctggcggcacccgatttccgggaaggcatccgggcgcaggtggtggacaaggac
cgcactccgcactggaagccgcccaccctggcagaggtatcgccggagcaggttgaacgt
tttttggaccgctgggcagccgcgaactggacctcggaaccggtccggagcatgggctga

DBGET integrated database retrieval system