KEGG   Pseudarthrobacter chlorophenolicus: Achl_0693Help
Entry
Achl_0693         CDS       T00834                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ach00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Achl_0693
DNA repair and recombination proteins [BR:ach03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Achl_0693
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Achl_0693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(733054..733653)
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQELIDELGRLPGVGPKSAQRLAFHILEADPQDMKRLVEAITTVKDRVKFCTVCG
NVTEQELCNICRDPRRDPALICVVEESKDVLAVERTRSFRGRYHVLGGAINPIAGIGPEQ
LRIRELLTRLNDGAIQEVIIATDPNLEGEATATYLARMLKTIGIAVTRLASGLPVGGDLE
YADEVTLGRAFEGRRNALG
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtgcggtccaggagcttatcgacgagctcggacgccttccgggagtcggt
cccaagtcggcgcagcggctggcattccacatccttgaagcagacccgcaggatatgaaa
cggctggtggaagccatcaccacggtcaaggaccgggtcaagttctgcactgtctgcggc
aacgtcacggagcaggagctctgcaacatctgccgggacccgcgccgcgatccggccctc
atctgcgtggtggaggagtccaaggatgtcctcgcggtggagcgtacgcgctcgttccgc
gggcggtaccacgtgctgggcggagccatcaatccgattgccggcatcggccccgaacag
ctgcgcatccgtgagctgctcacccggctgaatgacggcgccatccaggaagtcatcatc
gccaccgaccccaacctggagggcgaggcgacggccacctacctggcacggatgctcaag
accatcgggattgccgtcacgaggttggcctccgggctgcccgtgggcggcgacctggaa
tacgcggacgaggtcacgctgggccgcgcgttcgagggccggcggaacgccctgggctaa

DBGET integrated database retrieval system