KEGG   Pseudarthrobacter chlorophenolicus: Achl_0710Help
Entry
Achl_0710         CDS       T00834                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00620  Pyruvate metabolism
ach00630  Glyoxylate and dicarboxylate metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Achl_0710
   00630 Glyoxylate and dicarboxylate metabolism
    Achl_0710
Enzymes [BR:ach01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Achl_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI XPG_I_2
Motif
Other DBs
NCBI-ProteinID: ACL38707
JGI: Achl0710
UniProt: B8HBZ7
Position
complement(754365..756017)
Genome map
AA seq 550 aa AA seqDB search
MNSFTDSFTINGITMTAQPICRQDEVLTPDALAFIAKLHRATAERRQELLQARRTRRANI
AAGQDPRFLRETEHIRNDASWRVAPPAPGLEDRRVEITGPVDKKMTINAMNSGAKVWLAD
MEDSSTPTWRNVIKGQLNLTDALERRIDFTSDEGKEYKLKPAGELPTIVVRPRGWHLPEK
HMLIDGTPIAGGIVDFGLFFFHNARRLLAQGKGPYFYLPKIENHLEARLWNDIFILAQDL
LGIPQGTIRATVLIETITAAFEMEEILYELRDHASGLNAGRWDYIFSIIKNFRTRGPRFV
LPDRGQVTMTAPFMRSYTEQLVRACHKRGAMAIGGMAAAVPNRKDPEANANALEKVRADK
TREAGDGFDGSWVAHPDLVPICREVFDAVLGERPNQLDKLRDDVTPDDRALIDIASLHGT
ITEQGIRNNIEVGIRYIESWLRGNGAVAIHNLMEDAATAEISRSQLWQWIYARAITDHGE
IITHEWVEELLDGEFARLERFDGDRFEDARDIFEEVTLATEFPTFLTLPAYARYLTEARE
KATVEELAAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcaccgatagcttcaccatcaacggcatcaccatgaccgcccagcccatt
tgccggcaggatgaagtgctcacgcctgacgccctggccttcatcgccaagcttcaccgg
gccactgcggagcggcggcaggagctgctgcaggcacgaaggacccgccgcgccaacatc
gccgctggccaggacccccggttcctccgcgaaaccgagcacatccgcaacgatgcgtcc
tggcgggtcgctcccccggccccgggcctggaagaccgccgcgtggagatcaccggcccg
gtggacaagaagatgaccatcaacgccatgaactccggcgccaaggtctggctcgcggac
atggaagactcctccacccccacctggcgtaacgtcatcaagggccagctgaacctcacc
gatgccctggaacgccggatcgacttcaccagcgacgagggcaaggaatacaagctgaag
ccggcgggtgaactgcccaccatcgtggtccgcccccgcggctggcacctgcccgaaaag
cacatgctcatcgacggcacacccatcgccggcggcatcgtggacttcggcctgttcttc
ttccacaacgcccgccggctgctggcccagggcaagggcccgtacttctacctgccgaag
atcgagaaccaccttgaagcccggctctggaacgacatcttcatcctggcccaggacctg
ctcggcattccacagggcaccatccgcgccacggtgctcatcgaaaccatcaccgcagcc
ttcgaaatggaggagatcctctacgaactgcgggaccacgcctcgggcctgaacgccggc
cgctgggactacatcttctccatcatcaagaacttccgcacccgcggcccccgcttcgtc
ctcccggaccgcggccaggtgaccatgaccgccccgttcatgcgctcctacaccgaacag
ctggtccgggcctgccacaagcgcggcgccatggctatcggcggcatggccgccgccgtc
cccaaccgcaaggacccggaggccaacgccaacgccctcgagaaagtccgcgcggacaag
acccgcgaggccggggacggcttcgatggctcctgggtggcccacccggacctggtgccc
atctgccgtgaagtgttcgacgccgtcctcggcgagcgccccaaccagctggacaagctc
cgcgatgacgtcaccccggacgaccgcgccctcatcgatatcgcctccctgcacggcacc
atcacggagcagggcatccgcaacaacatcgaggtgggcatccgctacatcgagtcctgg
ctgcgcggcaacggcgcagtggccatccacaacctgatggaggacgccgccaccgcggag
atctcccgttcccagctgtggcagtggatctacgcccgggccatcaccgatcacggcgag
atcatcacccacgaatgggtggaggaactgctggacggcgaattcgcccggctggaacgc
ttcgacggcgaccgcttcgaggacgcccgggacatcttcgaggaagtcaccctcgccacg
gaattccccaccttcctcaccctcccggcctacgcccgctacctcaccgaggcccgcgaa
aaggccaccgtggaggagctcgcagcggcgtga

DBGET integrated database retrieval system