KEGG   Arthrobacter chlorophenolicus: Achl_0710Help
Entry
Achl_0710         CDS       T00834                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_0710
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Achl_0710
   00630 Glyoxylate and dicarboxylate metabolism
    Achl_0710
Enzymes [BR:ach01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Achl_0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(754365..756017)
Genome map
AA seq 550 aa AA seqDB search
MNSFTDSFTINGITMTAQPICRQDEVLTPDALAFIAKLHRATAERRQELLQARRTRRANI
AAGQDPRFLRETEHIRNDASWRVAPPAPGLEDRRVEITGPVDKKMTINAMNSGAKVWLAD
MEDSSTPTWRNVIKGQLNLTDALERRIDFTSDEGKEYKLKPAGELPTIVVRPRGWHLPEK
HMLIDGTPIAGGIVDFGLFFFHNARRLLAQGKGPYFYLPKIENHLEARLWNDIFILAQDL
LGIPQGTIRATVLIETITAAFEMEEILYELRDHASGLNAGRWDYIFSIIKNFRTRGPRFV
LPDRGQVTMTAPFMRSYTEQLVRACHKRGAMAIGGMAAAVPNRKDPEANANALEKVRADK
TREAGDGFDGSWVAHPDLVPICREVFDAVLGERPNQLDKLRDDVTPDDRALIDIASLHGT
ITEQGIRNNIEVGIRYIESWLRGNGAVAIHNLMEDAATAEISRSQLWQWIYARAITDHGE
IITHEWVEELLDGEFARLERFDGDRFEDARDIFEEVTLATEFPTFLTLPAYARYLTEARE
KATVEELAAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcaccgatagcttcaccatcaacggcatcaccatgaccgcccagcccatt
tgccggcaggatgaagtgctcacgcctgacgccctggccttcatcgccaagcttcaccgg
gccactgcggagcggcggcaggagctgctgcaggcacgaaggacccgccgcgccaacatc
gccgctggccaggacccccggttcctccgcgaaaccgagcacatccgcaacgatgcgtcc
tggcgggtcgctcccccggccccgggcctggaagaccgccgcgtggagatcaccggcccg
gtggacaagaagatgaccatcaacgccatgaactccggcgccaaggtctggctcgcggac
atggaagactcctccacccccacctggcgtaacgtcatcaagggccagctgaacctcacc
gatgccctggaacgccggatcgacttcaccagcgacgagggcaaggaatacaagctgaag
ccggcgggtgaactgcccaccatcgtggtccgcccccgcggctggcacctgcccgaaaag
cacatgctcatcgacggcacacccatcgccggcggcatcgtggacttcggcctgttcttc
ttccacaacgcccgccggctgctggcccagggcaagggcccgtacttctacctgccgaag
atcgagaaccaccttgaagcccggctctggaacgacatcttcatcctggcccaggacctg
ctcggcattccacagggcaccatccgcgccacggtgctcatcgaaaccatcaccgcagcc
ttcgaaatggaggagatcctctacgaactgcgggaccacgcctcgggcctgaacgccggc
cgctgggactacatcttctccatcatcaagaacttccgcacccgcggcccccgcttcgtc
ctcccggaccgcggccaggtgaccatgaccgccccgttcatgcgctcctacaccgaacag
ctggtccgggcctgccacaagcgcggcgccatggctatcggcggcatggccgccgccgtc
cccaaccgcaaggacccggaggccaacgccaacgccctcgagaaagtccgcgcggacaag
acccgcgaggccggggacggcttcgatggctcctgggtggcccacccggacctggtgccc
atctgccgtgaagtgttcgacgccgtcctcggcgagcgccccaaccagctggacaagctc
cgcgatgacgtcaccccggacgaccgcgccctcatcgatatcgcctccctgcacggcacc
atcacggagcagggcatccgcaacaacatcgaggtgggcatccgctacatcgagtcctgg
ctgcgcggcaacggcgcagtggccatccacaacctgatggaggacgccgccaccgcggag
atctcccgttcccagctgtggcagtggatctacgcccgggccatcaccgatcacggcgag
atcatcacccacgaatgggtggaggaactgctggacggcgaattcgcccggctggaacgc
ttcgacggcgaccgcttcgaggacgcccgggacatcttcgaggaagtcaccctcgccacg
gaattccccaccttcctcaccctcccggcctacgcccgctacctcaccgaggcccgcgaa
aaggccaccgtggaggagctcgcagcggcgtga

DBGET integrated database retrieval system