KEGG   Arthrobacter chlorophenolicus: Achl_0711Help
Entry
Achl_0711         CDS       T00834                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ach01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ach00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(756120..757436)
Genome map
AA seq 438 aa AA seqDB search
MTAAFEPTSQTPEEQAAALELEWAANPRWEGVTRDYSASDVVRLRGRVTEEQTLARRGAE
KLWKQLTEEHKTGGYTNALGALTGNQAVQQVKAGLRAIYLSGWQVAADANNSGHTYPDQS
LYPANSVPTVVRRINNALLRADQIEFSEGIQTVEDWLVPIVADAEAGFGGPLNAYELMKS
MIQAGASGVHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVAGTPTVVIARTD
AEAATLITSDVDERDQEFITGERTAEGFYKVRNGIEPCIARAKAYAPYSDLIWMETGTPD
LELARKFAESVKAEFPDQMLSYNCSPSFNWRKHLDDDTIAKFQRELGAMGFTFQFITLAG
FHALNYSMFDLAHGYAREGMSAYVELQEKEFASESRGYTATKHQREVGTGYFDTLSTALN
PNASTLALVGSTEEGQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcatttgagcccacctcgcagacgcctgaagagcaggccgccgccctggag
ctcgagtgggccgccaacccacgctgggaaggtgtgacccgggactactcagcctccgac
gtcgtccgcctccgcggtcgagtcaccgaagagcagacgctggcccgccgtggtgcggag
aagctgtggaagcagctcaccgaagagcacaagaccggcggctacaccaacgcactcggc
gccctcaccggcaaccaggccgtccagcaggtcaaggccgggctgcgtgccatctacctc
tccggctggcaggtggcggccgacgccaacaactccggacacacctacccggaccagtcc
ctctacccggccaactcggtccccaccgtggtccgccgcatcaacaacgccctgctccgt
gcggaccagatcgagttctccgaaggcatccagaccgttgaggactggctggtcccgatc
gtcgccgacgccgaggccgggttcggcggcccgctgaacgcctacgagctcatgaaatcc
atgatccaggccggcgcctccggtgttcactgggaggaccagctcgcctccgagaagaag
tgcggccacctcggcggcaaggtcctcatccccacccagcagcacgtccgcacccttaac
gcggccaggctcgcggccgacgtcgccggtacccccacggtcgtcatcgcccgcactgac
gccgaggcagcaaccctgatcacctccgacgtcgacgaacgcgaccaggaattcatcacc
ggcgagcgcaccgccgagggcttctacaaagtccgcaacggcatcgaaccctgcatcgcc
cgcgccaaggcctacgccccgtactcggacctcatctggatggaaacgggcacccctgac
ctggagctggcccgcaagttcgcggagtccgtcaaggccgagttcccggaccagatgctc
tcctacaactgctccccgtcgttcaactggcgcaagcacctggacgacgacaccatcgcc
aagttccagcgcgaactcggcgccatgggcttcacgttccagttcatcaccctggcagga
ttccacgccctgaactactcgatgttcgatctcgcccacggctacgcccgtgaaggcatg
agcgcctacgtcgagctccaggaaaaggaattcgcctccgagtcccgcggctacaccgca
accaagcaccagcgcgaagtcggcaccggctacttcgacaccctctccacggcgctcaac
ccgaacgcgtccaccctcgcattggtcggatcgaccgaagagggacagttccactaa

DBGET integrated database retrieval system