KEGG   Pseudarthrobacter chlorophenolicus: Achl_0711Help
Entry
Achl_0711         CDS       T00834                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00630  Glyoxylate and dicarboxylate metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Achl_0711
Enzymes [BR:ach01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Achl_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ACL38708
JGI: Achl0711
UniProt: B8HBZ8
Position
complement(756120..757436)
Genome map
AA seq 438 aa AA seqDB search
MTAAFEPTSQTPEEQAAALELEWAANPRWEGVTRDYSASDVVRLRGRVTEEQTLARRGAE
KLWKQLTEEHKTGGYTNALGALTGNQAVQQVKAGLRAIYLSGWQVAADANNSGHTYPDQS
LYPANSVPTVVRRINNALLRADQIEFSEGIQTVEDWLVPIVADAEAGFGGPLNAYELMKS
MIQAGASGVHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVAGTPTVVIARTD
AEAATLITSDVDERDQEFITGERTAEGFYKVRNGIEPCIARAKAYAPYSDLIWMETGTPD
LELARKFAESVKAEFPDQMLSYNCSPSFNWRKHLDDDTIAKFQRELGAMGFTFQFITLAG
FHALNYSMFDLAHGYAREGMSAYVELQEKEFASESRGYTATKHQREVGTGYFDTLSTALN
PNASTLALVGSTEEGQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcatttgagcccacctcgcagacgcctgaagagcaggccgccgccctggag
ctcgagtgggccgccaacccacgctgggaaggtgtgacccgggactactcagcctccgac
gtcgtccgcctccgcggtcgagtcaccgaagagcagacgctggcccgccgtggtgcggag
aagctgtggaagcagctcaccgaagagcacaagaccggcggctacaccaacgcactcggc
gccctcaccggcaaccaggccgtccagcaggtcaaggccgggctgcgtgccatctacctc
tccggctggcaggtggcggccgacgccaacaactccggacacacctacccggaccagtcc
ctctacccggccaactcggtccccaccgtggtccgccgcatcaacaacgccctgctccgt
gcggaccagatcgagttctccgaaggcatccagaccgttgaggactggctggtcccgatc
gtcgccgacgccgaggccgggttcggcggcccgctgaacgcctacgagctcatgaaatcc
atgatccaggccggcgcctccggtgttcactgggaggaccagctcgcctccgagaagaag
tgcggccacctcggcggcaaggtcctcatccccacccagcagcacgtccgcacccttaac
gcggccaggctcgcggccgacgtcgccggtacccccacggtcgtcatcgcccgcactgac
gccgaggcagcaaccctgatcacctccgacgtcgacgaacgcgaccaggaattcatcacc
ggcgagcgcaccgccgagggcttctacaaagtccgcaacggcatcgaaccctgcatcgcc
cgcgccaaggcctacgccccgtactcggacctcatctggatggaaacgggcacccctgac
ctggagctggcccgcaagttcgcggagtccgtcaaggccgagttcccggaccagatgctc
tcctacaactgctccccgtcgttcaactggcgcaagcacctggacgacgacaccatcgcc
aagttccagcgcgaactcggcgccatgggcttcacgttccagttcatcaccctggcagga
ttccacgccctgaactactcgatgttcgatctcgcccacggctacgcccgtgaaggcatg
agcgcctacgtcgagctccaggaaaaggaattcgcctccgagtcccgcggctacaccgca
accaagcaccagcgcgaagtcggcaccggctacttcgacaccctctccacggcgctcaac
ccgaacgcgtccaccctcgcattggtcggatcgaccgaagagggacagttccactaa

DBGET integrated database retrieval system