KEGG   Arthrobacter chlorophenolicus: Achl_0847Help
Entry
Achl_0847         CDS       T00834                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_0847 (gpmA)
   01230 Biosynthesis of amino acids
    Achl_0847 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_0847 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Achl_0847 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_0847 (gpmA)
Enzymes [BR:ach01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Achl_0847 (gpmA)
Exosome [BR:ach04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Achl_0847 (gpmA)
  Exosomal proteins of melanoma cells
   Achl_0847 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
919188..919934
Genome map
AA seq 248 aa AA seqDB search
MTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGRAEAARGGELLVENNILPDVLYTSLLK
RAINTANIALDKADRGWIPVKRDWRLNERHYGALQGKDKAQTLAEYGEEQFMEWRRSYDT
PPPPLDDNSEFSQAHDPRYADLGDALPRTECLKDVLVRILPYWESDIKADLKAGKTVLVT
AHGNSLRALVKHLDGISDEAIAGLNIPTGIPLVYDLDDDFQPVKPGGTYLDPEAAEQAIL
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagctgatcctgctgcgccacggccacagcgaatggaacgccaagaacctg
ttcaccggctgggtggacgttgacctgaacgaccagggccgcgcggaagcagcgcgcggc
ggcgagctgctggtggagaacaacatcctccccgacgttctgtacacctccctgctgaag
cgggccatcaacaccgccaacatcgccctggacaaggccgaccgcggctggatcccggtc
aagcgcgattggcgcctgaacgaacgccactacggtgcgctgcagggcaaggacaaagcc
cagacgctggccgagtacggcgaagagcagttcatggaatggcgccgctcctacgacacc
ccgccgccgcccctggatgacaacagcgaattcagccaggcacacgatccgcgctacgca
gaccttggcgacgcccttccgcgcaccgagtgcctgaaggacgtcctggtccggatcctg
ccgtactgggaatccgacatcaaggctgacctgaaggcgggcaagaccgtcctggtcacg
gctcacggcaactccctgcgcgcgctggtcaagcaccttgacggcatcagcgacgaagcc
atcgccggcctcaacatccccaccggcatcccgctggtctacgatctggacgacgacttc
cagccggtcaagccgggcggcacctacctcgaccccgaggccgccgagcaggccatcctg
gccgtagccaaccagggcaagaaatag

DBGET integrated database retrieval system