KEGG   Arthrobacter chlorophenolicus: Achl_0863Help
Entry
Achl_0863         CDS       T00834                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Achl_0863
Enzymes [BR:ach01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Achl_0863
Exosome [BR:ach04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Achl_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
938225..941947
Genome map
AA seq 1240 aa AA seqDB search
MNQPILTPALTTLLKEWLPKQRWFPVNSPDFEMSQAGSLGIEDPSGHAGLAVFLLNITTG
PSDGGGRTLVVQVPLSFRSAPAAGMERALVGQAAGTDPSRTWVYDALHDPDFIGGWLELI
RHEATARTGVAAGFKASGDYRLPTAHGVVKVLSGEQSNTSVIVDDGESAAIVKFFRTLSA
GTNPEVEVGAALTAAGTSEVPATLGWVRGEWLENGTNAGGTARATRPVQGELAVAHEFLA
GGLDAWRLAVDAARSGRDFTAEARALGAATATVHRRLAETLGRTEAAGSGEDVAAGVARR
IRAAWAEAGPAVGPYDEALGALLDGLDGANAGPLQRIHGDLHLGQILQVPHAAGRTEPLA
AAEPEPRWAILDFEGEPLRPIDERNGPDVPLRDVAGMLRSFDYAAGAAQREQEGAHVPAS
WVDDCADAFLAGYAKVTPGTVDRTSPLFVALWLDKALYEVVYEMRNRPDWLAIPVSASRR
LLGGNGAGDTAGAASEGNEMTGTARTGRPGAPLPVDDGTLGKIANGEHHAPHSVLGAHLD
DYGHVTVRTVKHLAEAVSVITAAGEVPMQHEAHGAWVAVLEPGEHGHVPDYRLSVTYPGA
DPVTVDEPYRYLPTVGEVDLHLIGEGRHEKLWQVLGAHVQHYKSSLGDVDGVSFAVWAPN
AQAVRVKGDFNGWDGREHSLRSLGSSGIWELFIPGVVAGACYKFEIRTKAGYWVEKADPL
AFGTEVPPLTASRVVEPSYAFKDDEWMQARSERDPHNSAMSVYEVHLGSWRLGLGYRELA
KELVDYVKWLGFTHVEFMPVAEHPFGGSWGYQVTSYFAPTSRFGHPDEFRYLVDTLHQAG
IGVLLDWVPAHFPKDSWALAQFDGQPLYEHADPTLGEHPDWGTLIFDFGRTEVRNFLVAN
ALYWLDEFHIDGLRVDAVASMLYLDYSREEGQWRPNRFGGRENLEAISFLQEVNATVYKT
HPGAVMIAEESTAFPGVTAPTSHGGLGFGLKWNMGWMHDSLKYASEDPVNRKWHHGGLTF
SLVYAFTENFLLPISHDEVVHGKGSMLRKMPGDRWQQLANLRAFLAYQWAHPGKQLIFMG
TEFGQEAEWSEQHGLDWWLADIPAHKGIQLLTKDLNELYASTPSLYARDNEPAGFQWING
GDADRNVLSFIRRDGDGNPVVCAINFSGAPHAGYTLGVPQAGAWTEVLNTDHTTYGGSGV
LNNGELKATDEGQDGQPATLTVTLPPLGASFFIPGAPAPR
NT seq 3723 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagccaatactgactcccgccctgaccacgctcctgaaggaatggcttccgaag
cagcgatggttccccgtcaacagccccgacttcgagatgtcgcaggcaggcagcctggga
attgaagacccctcggggcatgcggggctggcggtgttcctgctgaacatcaccacaggc
ccgtccgacggcggcggccgcactttggtggtgcaggttccgttgagcttccggtcggcg
cccgcggccggcatggaacgggcgttggtgggacaggcggccgggacggacccgtccagg
acctgggtttacgacgccctccacgaccccgacttcatcggcggctggctggaactcatc
cggcacgaagccacggcacgcaccggcgtggccgcgggcttcaaggcatccggagactac
cggctccccaccgcccacggagtggtcaaggtgttgtccggcgagcagtccaacacctca
gtgattgttgacgacggcgagtccgcagcaatcgtgaagttcttccggacactgtccgcc
ggaaccaatccggaagttgaagtgggcgcagccctgaccgctgccggcacctcggaggtc
cccgccacgctgggctgggtcaggggagagtggttggagaacggcaccaacgcaggcggg
accgcgagggcaacccgtccggtgcagggcgagcttgccgtggcccacgaattccttgcc
ggtggattggatgcctggcggctcgccgtggatgcagcacgttccggcagggacttcacc
gcggaggcacgggcactcggcgcggcaacggccaccgtccaccgccggctcgccgaaacg
cttggccgcacagaggctgccggttccggtgaggacgtcgcggcgggagtagcccggcgt
atccgcgcggcctgggccgaggccggtcccgccgtcggcccctacgacgaggcgctgggc
gcccttcttgacgggctcgacggcgccaatgcaggtccgctccagcggatccacggcgac
ctgcacctgggccagatcctgcaggtgccccacgctgcaggccgaacggaaccactcgcc
gccgctgaaccggagccccgctgggccatcctcgatttcgagggagaaccgctgcgcccc
attgatgagaggaacggccccgatgtgcccttgcgggacgtcgccggcatgctgcgctcc
ttcgactacgcggccggtgccgcccagcgcgagcaggagggggcccacgtgcccgcgtcc
tgggttgacgactgcgccgacgcgttcctcgccggctacgcgaaggtcacccccggcacc
gtagaccggacctcgccgctgtttgtggcattgtggctggacaaggcgctgtacgaagtt
gtttatgaaatgcgtaacaggcccgattggctggcgattccagtaagcgcctccaggcgg
ctcctgggcggtaacggcgccggcgacaccgccggcgcagcatcggaaggtaacgaaatg
acaggcacagcacgaacaggacggccgggggctccgctcccggtggacgacggcaccctg
ggcaagatcgccaatggtgaacaccacgcgccgcactccgtactgggggcgcacctggat
gactacggtcacgtcaccgtccgcacggtgaagcacctggcggaagccgtcagcgtcatc
accgctgcaggggaagtgccgatgcagcacgaggcacatggggcctgggtagcggtgctt
gagccgggcgagcacgggcacgtcccggactaccgcctgtccgtgacgtaccccggggct
gacccggtcacggtggacgagccctaccggtacctgccgacagtcggtgaggtggacctg
caccttatcggcgaaggccgccacgaaaagctctggcaggtcctgggcgcacacgtccag
cactacaagtcctccctgggagatgttgacggtgtttccttcgccgtgtgggcccccaat
gcacaggccgtccgcgtaaagggcgacttcaacggttgggacggacgcgaacactcgctc
cgctcactggggtcctccggcatctgggaactcttcattcccggggttgtagcaggggcg
tgctacaaattcgagatccgcaccaaggccggctactgggtggaaaaagcggacccgctg
gcgttcggaaccgaggtcccgccgctcacggcatcccgcgtggtggaaccgtcctacgct
ttcaaggacgacgagtggatgcaggcccgttccgaacgcgatccgcataactcggccatg
agcgtgtacgaggtccacctcggatcctggcgcctcgggcttggataccgcgaacttgcc
aaggagctcgtggactacgtcaagtggctgggcttcacgcacgtggagttcatgccggtt
gccgagcaccccttcggcggttcctggggctaccaggtcacttcctactttgccccgacg
tcccggttcggccaccccgacgagttccgctacctggtggacaccctgcaccaggccggc
atcggcgtcctgctggactgggtccctgcccacttccccaaggattcatgggcgctggca
cagttcgacggccagcccctatacgaacacgccgaccccaccctgggtgaacaccccgac
tggggaacgctgatcttcgacttcggccgtaccgaggtgcgcaacttcctggtggcgaac
gcattgtactggctggatgagttccacatcgacggactgcgggtggatgccgtggcatcg
atgctgtacctggactactcccgcgaggaaggacagtggcggcccaaccggttcggtggg
cgggagaacctcgaagcgatctccttcctccaagaagtcaacgccacggtctacaagacc
caccccggtgccgtgatgatcgccgaggagtcaacggcgttcccgggcgtaaccgcaccc
accagccacggcggactgggattcggcctgaaatggaacatgggctggatgcacgattcc
ctgaagtacgcctccgaggacccggtcaaccgcaaatggcaccacggcggcctgacgttc
tcgctggtttatgccttcacggaaaacttcctgctgcccatcagccacgacgaagttgtg
cacggcaagggctccatgctccgcaagatgccgggggaccgctggcagcagctggcaaac
cttcgcgctttccttgcgtaccagtgggcacaccccggtaagcagctgatcttcatgggc
accgagtttggccaggaagcggagtggtcggagcagcatgggctggactggtggctcgct
gacatcccggcccacaaggggatccaactgctgaccaaggacctgaacgagctctacgcg
tccacgccatccctttacgcccgcgacaacgaacccgccgggttccagtggatcaacggc
ggagacgctgacaggaacgtactttccttcatccgccgtgatggggacggcaacccggtg
gtttgcgccatcaacttctccggagcgccgcacgccggctacacactgggtgttccccag
gcaggcgcttggacagaagtgctcaacaccgaccacaccacctacggcggctccggcgtc
ctgaacaacggagagctgaaggccaccgatgaaggacaggacgggcagccggcaacgctg
accgtcacccttcctccgctgggtgcatccttctttattccgggagcgccggcaccccgc
tag

DBGET integrated database retrieval system