KEGG   Arthrobacter chlorophenolicus: Achl_0967Help
Entry
Achl_0967         CDS       T00834                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Achl_0967
Enzymes [BR:ach01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Achl_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1059617..1060681
Genome map
AA seq 354 aa AA seqDB search
MEELRIEANGNLGPIDSSRIPRYAGAATFARLPRLDQVAKADVTVVGVPFDSGVSYRPGA
RFGANHVREASRLLRPYNPAWDVSPFENIQVADAGDMAVNPFNINEAIETIQQNALDLTS
GGSKLVTLGGDHTIALPLLRAAAERAGGPIAMLHFDAHLDTWDTYFGAEYTHGTPFRRAV
EEGILDTEAISHIGTRGPLYGKKDLDDDHRFGFGIVTSADVYYQGVLETVAKVRDRIGNR
PLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRGFRGMNLVGADVVEVAPAYDHAE
ITGVAGSHVAYELVTLMADSAVPGDRFGAPTGYAAQALGQEVRRPAGFAAAGKE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaagagctgcgcatcgaagccaacggcaaccttggacccatcgactcatcccggatt
ccgcgttacgccggagcggccacgtttgcgcgccttccgcggctggaccaggtggccaag
gcagacgtcacggtggtgggcgtgcccttcgactcaggcgtctcctaccggccgggtgcc
aggttcggggccaaccatgtccgggaagccagccgcctgctccgcccgtacaacccggcc
tgggacgtcagcccgttcgaaaacatccaggtggccgacgccggggacatggccgtcaac
cccttcaatatcaatgaggccatcgaaaccatccagcagaacgcccttgacctcacctcc
ggcggcagcaagctggtgacgctcggcggcgaccacaccatcgcgctgccactgcttcgc
gccgccgccgaacgcgccggcggcccgatcgccatgctgcacttcgacgcgcacctggac
acctgggacacctacttcggcgctgaatacacccacggaactccgttccgccgtgccgtc
gaggaaggcatcctcgacaccgaggccatcagccacatcggcacccgcggcccgctgtac
ggtaagaaggacctcgacgacgaccaccgcttcggtttcggcatcgtcacctcggcggat
gtctactaccagggcgtcctggagaccgtggccaaggtccgtgaccggatcggcaaccgc
cccctctacatctcggtagacatcgacgtcctcgacccggcgcacgcacccggcaccgga
accccggaagcaggcggcatcaccagccgcgaactcctggaaatcatcaggggcttccgc
ggcatgaacctggtaggcgccgacgtcgtggaggttgccccggcctacgaccacgcagaa
atcaccggcgtcgccggaagccatgtggcctatgagctggtgacgctgatggcggacagc
gccgtcccgggcgaccgcttcggtgccccgaccggctacgccgcccaggccctcgggcag
gaagtccgccggccggcagggttcgcagcagcgggcaaggagtag

DBGET integrated database retrieval system