KEGG   Arthrobacter chlorophenolicus: Achl_1013Help
Entry
Achl_1013         CDS       T00834                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_1013
  Energy metabolism
   00680 Methane metabolism
    Achl_1013
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Achl_1013
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Achl_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1114858..1116069
Genome map
AA seq 403 aa AA seqDB search
MTGNKAVAYKEPGKVEVIDVDYPTFELKDGPGVNPANVGRAVNHGVILKTVATNICGSDQ
HMVRGRTTAPPDLVLGHEITGEVVEVGRDVEFIKVGDICSVPFNIACGRCRNCKERKTGI
CLNVNPDRPGSAYGYVDMGGWVGGQANYVLVPYADWNLLKFPDRDQALEKMLDLTMLSDI
FPTGFHGAVTAGVGVGSTVYVAGAGPVGLAAATSAHLLGAAVVIVGDMNADRLAQAKSFG
CETVDLSKGGPAEQIEQILGVPEVDCGVDAVGFEARGHGSNASEAPATVLNSLMEITSAG
GALGIPGLYVTGDPGGIDEAAKKGALSLSLGTGWAKSLSFTTGQCPVMKYNRGLMMAILH
DKVHIAKNVNAKAIALEDAPKGYAEFDAGAATKYVLNPNGYLS
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaacaaagccgttgcctacaaggaacccggcaaggtcgaggtaatcgatgtt
gactatcccaccttcgaactgaaggacggcccgggcgtcaacccggccaacgtgggacgt
gcggtcaaccacggggtgatcctcaagaccgtggccaccaatatctgcggctcggaccag
cacatggtgcgcggccgcaccacagcaccgccggacctggtgctgggccacgaaatcacc
ggtgaagtggtggaggtgggccgcgacgtggagttcatcaaggtgggcgatatctgctcg
gtgccgttcaacatcgcctgcgggcggtgccggaactgcaaggagcggaagaccggcatt
tgcctgaatgtgaacccggaccgccccggcagtgcctacggctacgtggatatgggcggc
tgggtgggcggccaggccaattacgtcctggtgccgtacgcggactggaacctgctcaaa
ttcccggaccgggaccaggccctggagaagatgctggacctgaccatgctttcggacatc
ttccccacgggattccacggagccgtgaccgccggcgtgggcgtcggttccacggtgtat
gtggcgggtgccgggcctgttggcctcgcagcggcaaccagcgcgcacctgctgggtgcc
gccgtcgtaattgtgggcgacatgaacgccgaccgcctggcccaggccaagagcttcggc
tgcgagacggtggacctgagcaagggcggcccggccgagcagatcgaacagatcctgggt
gtcccggaggtggactgcggcgtggacgccgtgggcttcgaggcgcgcgggcacggcagc
aacgcctcggaggcgccggccacggttctgaactccctgatggagatcacctcagccggc
ggcgccctgggcattcccgggctctacgtcacaggggatccgggcggcatcgacgaggcc
gccaagaagggtgcgctgagcctgagcctcggcacgggctgggccaaatcgctgagcttc
accaccggccagtgtccggtgatgaagtacaaccgcgggctgatgatggcgatcctgcat
gacaaggtccacatcgccaagaacgtcaacgccaaagcgattgccctggaggacgcgccg
aagggctacgccgagttcgacgccggtgccgccaccaagtacgtgctgaacccgaacggc
tacctcagctag

DBGET integrated database retrieval system