KEGG   Arthrobacter chlorophenolicus: Achl_1048Help
Entry
Achl_1048         CDS       T00834                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ach00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1144656..1146107
Genome map
AA seq 483 aa AA seqDB search
MTLPKGFRWGGAVAANQVEGAWREGGRGPAVSDVASYKPNADPTEYALHHAYTVDGIKAA
LADDDVAYYPKRRGIDFYHRYPGDLALFAEMGFTTLRVSIAWTRLYPTGEELEPLAEGVA
YYEALFTEMRRLNIEPLVTLSHYDPPMALALKHNGWVERRTIELFERFARTCFERFGHLV
KMWLTFNEIDGIIRHPFTSGGIIEELVEGDLEQACYTALHHQFVASASVTRMLREISPDA
QMGCMLTMLTTYPNTCHPDDVAATQAKERLLYLCTDVQAGGAYPRLALRALERRGVKIPF
EKGDEELLKEHPVDFISFSYYMSMTESVRPDAERTPGNTVLGVKNPFLPSSEWGWQIDPV
GLRISLIDLYDRYGKPLFIVENGLGMRDELTDDRKIHDPYRIDYFRAHFEQMIQAVEEGV
DLMGYVSWAPIDLISASSSQISKRYGFIYVDQDDLGQGTQERLRKDSFYWYQKVIASNGA
DLA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacccaagggattccgatggggcggtgcggttgccgccaaccaagtcgaaggt
gcctggcgggaaggcggccgcggcccggccgtctccgacgtggccagctacaagcccaac
gccgaccccaccgaatacgcgctgcaccacgcctacaccgttgacggcatcaaggcagca
ctggcagacgacgacgtcgcgtactaccccaagcgccgcggcatcgacttctaccaccgc
taccccggggacctagcactattcgctgagatgggctttactaccctccgggtctccatc
gcctggacccggctgtaccccaccggcgaagagctggagcccctcgcggaaggcgtcgcc
tactacgaggcgctgttcacggagatgcgccggctgaacatcgaacccctggtcacactc
tcgcactacgacccgcccatggccctggccctcaaacacaacggctgggtggaacgcagg
accatcgaactgttcgaaaggtttgcccggacctgcttcgagcgcttcgggcacctcgtg
aagatgtggctgacgttcaacgagattgacggcatcatccggcacccgttcacctccggc
ggcatcatcgaagaactcgtcgagggtgacctcgaacaggcctgctatacggccctgcac
caccagttcgtcgcatccgcttcggttaccaggatgctgcgcgaaatctccccggacgca
cagatgggctgcatgctcaccatgctcaccacctatccgaacacctgccacccggacgac
gtcgcggccacccaggcgaaggaacgcctgctctacctgtgcaccgacgtgcaggccggc
ggcgcatacccgcgcctggccctccgcgccctggagcggcgcggcgtgaagattcccttc
gagaagggcgacgaggaactgctcaaggagcacccggtcgacttcatctccttcagctac
tacatgtccatgaccgagtcggtccggcccgatgccgaacggacccccggaaacaccgtg
cttggagtcaagaacccgttcctgccttccagcgagtggggctggcaaattgacccggta
ggcctgcgcatctcgctcatcgacctttacgaccggtacggcaagccgctgttcatcgtg
gagaacggccttggcatgcgggacgagctcaccgacgacaggaagatccacgacccctac
cggatcgactatttccgcgcccacttcgagcagatgatccaggccgtcgaggagggcgtg
gacctcatgggctacgtcagctgggcacccatcgacctgatctccgcctccagctcccag
atctccaagcggtacggtttcatctatgtggatcaggacgaccttggacagggaacgcag
gaacggctccggaaggactccttctactggtaccagaaggtcatcgcgtcgaatggtgcc
gaccttgcctga

DBGET integrated database retrieval system