KEGG   Arthrobacter chlorophenolicus: Achl_1215Help
Entry
Achl_1215         CDS       T00834                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ach00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1337067..1338398
Genome map
AA seq 443 aa AA seqDB search
MTETRATDSIAEAFDAVDIIRVKRDKGTLSPEQIDWTIDAYTRGVIADEQMAALNMAILL
NGMDRTEIARWTAAMIASGERMDFSSLRRPDGGLKYTSDKHSTGGVGDKITLPLAPLVAV
FGVAVPQLSGRGLGHTGGTLDKLEAIPGWRASLSNDEILAQLQDVGAVICAAGAGLTPAD
KKLYALRDVTGTVEAIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDEAKARELAETM
VALGQDAGVNTVALLTNMGTPLGLTAGNAIEVEESVEVLAGGGPADVVELTVRLAEEMLA
CAGVRDADPAAALKDGRAMDVWNRMIRAQGGDPAAKLPVARESEVLYAPADGVLVELDAL
AVGVAAWRLGAGRARKEDAVQAGAGVRMHAKPGALVRAGEPLMTLLTDTPERFDRAKEAL
EHAAVIAPEGSRPAQQLIIDRIA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgacagagacccgcgcaacggacagcattgccgaagcattcgacgccgtcgacatcatc
cgcgtcaagcgggacaagggcacgctgagcccggagcagatcgactggaccatcgatgcc
tacacccgcggcgtcatcgcggatgagcagatggccgcgctgaacatggccatcctgctc
aatggcatggaccggaccgagattgcgcgctggacggccgcgatgatcgcatccggcgaa
cggatggacttctccagcctccgtcgccccgacggcggcctgaaatacacgtcggacaag
cactccaccggcggcgtgggagacaagatcaccctgccgctggctccgctcgtggcggta
ttcggcgttgcagtcccgcagctgtccggccgcggcctggggcacaccggcggcaccctg
gacaagctggaggcgattcccggctggcgggcgtccctgagcaacgacgaaatactcgcc
cagctccaggacgtgggcgctgtcatctgcgccgccggggcaggcctgaccccggccgat
aagaagctgtacgccctgcgcgacgtcaccggcacggtggaggccatcccgctgatcgcc
tcgtccatcatgagcaagaaaatcgccgagggcaccggttccctggtgctcgatgtgaag
gtgggcagcggcgccttcatgaaggatgaggcaaaggcccgcgagctggcggagaccatg
gtggccctgggccaggacgccggcgtgaacacggtggcactgcttaccaacatgggcacc
ccgctcggcctgaccgccgggaacgcgattgaagtcgaggagtcggtggaggtgctggcg
ggcggcggcccggccgacgtcgtcgaactgacggtcaggctcgccgaggaaatgctcgcc
tgcgcgggagtgcgcgacgccgatccggccgctgcgctcaaggacgggcgcgccatggac
gtctggaacaggatgatccgtgcccagggaggtgaccccgccgcgaagctgccggtggcc
cgtgagtcagaggtgctctacgctcccgccgacggcgtcctggtggaactggatgccctc
gccgtgggcgtggccgcctggcgattgggcgccggacgtgcccgcaaggaggatgcggtg
caggccggcgcaggggtgcgcatgcatgccaagccgggcgcactggtccgggcaggtgaa
ccgctgatgaccctgctcacggacacccccgaacgcttcgacagggcaaaggaagcgctg
gagcacgcagcggtcatcgcaccggaggggtcccggccggcacagcagttgatcatcgac
cgaatagcatag

DBGET integrated database retrieval system