KEGG   Arthrobacter chlorophenolicus: Achl_1284Help
Entry
Achl_1284         CDS       T00834                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Achl_1284
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Achl_1284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1415082..1416044
Genome map
AA seq 320 aa AA seqDB search
MNTPAVRFAARTVRVKAPGKINVSLDVGPRRPDGYHSVASVYLAVSLYEEVAATSTETPG
ITVSLSPDSTLDLDAVDIPLDASNLAYRAAAIMADVSEHATGVHLEITKRVPVAGGMGGG
SADAAATLLACDALWNSGLSREELAHLAAELGADVPFSLLGGTAVGLGVGDQLSPALAKA
KTHWVLVTADFGLSTPEVFRTLDRLREAEGVDADEPTGVDPNILAALRGGDADALSRILV
NDLQRASIELAPSLRDTLGIGESHGAIAGIVSGSGPTVALLADDSVAAEALAEDLQHQGL
SALAVHGPVPGARIISDTLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccccgccgtccggttcgctgcgcggacggtccgggtcaaggctcccggaaag
atcaacgtctcgctggacgtcgggccgcgccggcctgatggctaccattccgtggccagc
gtctacctcgctgtctcgctctatgaagaagtcgcggccaccagcacggagacgcccggc
atcactgtgagcctgagcccggacagcacccttgaccttgacgccgtcgacatccccctc
gacgccagcaacctggcttacagggccgccgccatcatggctgacgtttccgaacatgcc
acaggggtccacctggaaatcaccaagagggtgcccgtggccggcgggatgggcggggga
tcggcggacgccgccgccacgctcctggcctgtgatgcattgtggaacagcggcctctcc
cgggaggagctcgcacaccttgctgccgaactcggagccgacgttccgttctccctgctc
ggcggaacggcggtggggctcggggttggtgaccagctgtcgccggcactcgccaaggca
aagacccactgggtcctggttaccgctgatttcggactgtccacaccggaagtcttccgg
accctggacaggctgcgggaagcggagggcgtagacgcggacgagcccaccggcgtcgac
ccgaacatcctggccgccctgcgcggcggcgacgcagacgccctgagccgcatcctggtc
aacgacctccagcgggcctccattgaactggccccctcactgcgcgatacgctgggcatc
ggcgaatcgcatggcgccatcgccggcatcgtgtccggctccgggcccaccgtggccctg
ctcgcggatgactccgtggcagcggaagcactggcggaagacctgcagcaccaaggcctg
tccgccctcgccgtccacggacccgtccccggcgcccgcatcatctccgacacccttctc
tag

DBGET integrated database retrieval system