KEGG   Arthrobacter chlorophenolicus: Achl_1549Help
Entry
Achl_1549         CDS       T00834                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_1549
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_1549
   00052 Galactose metabolism
    Achl_1549
   00500 Starch and sucrose metabolism
    Achl_1549
   00520 Amino sugar and nucleotide sugar metabolism
    Achl_1549
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Achl_1549
   00524 Butirosin and neomycin biosynthesis
    Achl_1549
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Achl_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1734743..1735834
Genome map
AA seq 363 aa AA seqDB search
MYAPPSGDQAGHLRRSAPWKRRSAPYRAASGQGKGSRGRARLGRRGLAIGIDIGGTKVAA
GVVDEEGRILSEARRSTPGTDPRAVERVIVELVEELGSGRRIRSVGIGAAGWMDLDGGTV
LFSPHLAWRNEPLRANLQQLLRRPVLLANDADAAAWAEWRFGAGQGESRLVCITLGTGIG
GAMVMDGRVERGRFGVAGEFGHQVIMPGGHRCECGNRGCWEQYASGNALGREARILASSN
SPMAQDLLAAVGGRAETITGAVVTELALAGDTASRELIEEVGEWLGLGLANLAAALDPGL
FVIGGGLCSAGDLLVEPARKAFARNLTGRGFRPAAGIELAHLGPNAGLIGAADLSRVSSR
VRS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcaccgccctccggcgaccaggccggccacctccgtcgatccgcgccgtggaag
cggcggtccgccccgtaccgtgccgcctcagggcagggaaaaggatcccgggggcgggcg
cgccttggccgccggggcctggcgatcggcatcgacatcggcggcaccaaggtggcggca
ggtgtcgtggacgaggaaggccggatcctcagcgaagcccgccgcagcacgcccgggact
gatcccagggctgtggaacgggtcatcgtggaactggtcgaagagctcggcagcgggcgg
cggatacgttccgtgggcatcggcgccgccggatggatggacctcgacggcggcactgtc
cttttcagcccccacctcgcctggcggaacgagcccctgcgcgcgaacctccagcagctc
ctgcggcgtccggtgctgctggccaacgatgccgacgccgccgcgtgggccgagtggcgg
ttcggcgccgggcaaggcgaaagccgcctggtatgcatcaccctcggcaccggaatcggt
ggagccatggtgatggacggcagggtggaacggggccgcttcggcgtagccggcgagttc
ggccaccaggtcatcatgcccggaggccaccgctgcgaatgcggcaaccgcggctgctgg
gagcagtatgcctccggtaacgccctcggccgcgaagcgaggatccttgccagcagcaac
tcgcccatggcccaggacctcctggctgccgtcggtggtcgcgctgagaccattaccggt
gccgttgtcaccgagctggccctcgccggagatacagcatcgcgcgaactgatcgaagag
gtgggggagtggctcggcctggggctcgccaacctggcggccgccctcgacccggggctc
ttcgtcatcggcggaggactgtgttcagcaggcgatctcctcgtggagcccgccaggaag
gcgttcgccaggaacctgaccggccgtggcttccggccggccgccggtatcgagttggcc
caccttggacccaacgccggcctgatcggtgccgccgacctctcccgcgtcagcagccgg
gtccgcagctga

DBGET integrated database retrieval system