KEGG   Arthrobacter chlorophenolicus: Achl_1566Help
Entry
Achl_1566         CDS       T00834                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Achl_1566
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Achl_1566
Enzymes [BR:ach01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Achl_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1752727..1754364
Genome map
AA seq 545 aa AA seqDB search
MSDFTPSHSSAVPAAPASKARFRPAAVEPVRLASIGAAVGVAVPGHAADVTVTGITLNSR
SVEAGDLYVALPGASRHGADFVAQAVGAGAVAVLTDDAGARLLALGNDTPVPVLVVDKPR
NVVGPLSAAIYGSTDGAEDDFTLFGVTGTNGKTTTTYFINSLLRALGTRSGLIGTIEILA
GTEPIPSLLTTPESTEVHGLLALMRERGLGAAAMEVSSHAISYQRVDGVLFDVAGFTNLT
QDHLDLHGTMDDYFATKAELFTPARARRAVVTVDDEWGRRLAGTAGIPVTTLSTDGQAAA
DWAVATTEPRGLGTAFTLKGPDGAELRLHTGLPGSFNVANAALAAVMVLAGGVDHAVLQE
AVDTADPFTVAVPGRMQLVAEQPAAVVDFAHNTDALARALEAVRPPAPDSRLIVVFGATG
QRDQGKRPAMGAVAARLADTVIITDDDPHDEDAAAIRADVLAGAEHARSSESLPCEILEV
FPRDEAIRRAVELAGPSDSILVAGRGHEVWQEVKGVNLALDDRVELRSALTARGFNVLQD
DRIES
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagacttcacgccgtcccacagcagcgccgttccggccgctcctgccagtaaggcc
aggttccggcccgccgccgtcgaacccgtccgcctggcgagcatcggcgccgccgtaggc
gtcgcagttcccggacatgcagcagacgtcacggtaacgggaatcaccctgaactcccgg
tccgtcgaagccggagacctctacgttgccctccccggggcttcccgccacggtgctgat
ttcgtggcacaggccgtgggcgccggcgcggtggcggtcctgaccgacgacgccggtgca
cgcctgctggcgctgggaaacgacaccccggttccggtcctcgtggtggacaaaccccgc
aacgtagtgggtccgctgtccgcagccatctacggcagcaccgacggcgccgaggatgat
ttcacgctgtttggcgtgaccggcaccaacggcaagaccaccaccacgtacttcatcaac
tcattgctgcgcgccctcggcacccggtccggcctgatcggcaccatcgaaatccttgcc
ggcacggagcccattcccagcctgctgaccacgccggagtccaccgaagtgcacgggctg
cttgccctcatgcgcgagcggggactgggagcggcagccatggaggtttcctcacacgcc
atctcgtaccagcgcgtggacggcgtgctgtttgacgtggccggcttcaccaacctgacg
caggaccacctggacctgcacggcaccatggatgactacttcgccaccaaagccgaactg
ttcacgcccgcccgcgcccgcagggcagtagtgacggtcgacgacgagtggggccgccgc
ctggccggcaccgccggcatcccggtcaccaccctcagcacggacgggcaggcagccgcg
gactgggccgtggccaccaccgaaccccggggcctcggcaccgctttcacgctcaaaggt
cccgatggcgcagaactgcgcctgcacaccggactgcccggcagctttaacgtcgccaac
gccgccctggcggcggtaatggtcctcgccgggggtgtggaccacgcggtgcttcaggaa
gccgtggacacggccgacccattcaccgtcgccgtccccggacgcatgcaacttgtcgcc
gagcagcccgccgccgtcgtcgatttcgcccacaacaccgatgccctggcccgtgccctc
gaggccgtccgcccgccggcgccggactcccggctgatcgtcgtcttcggcgccaccggc
cagcgcgaccagggcaaacgccctgccatgggcgccgtggctgcccggctggcggacacg
gtcatcatcactgacgacgacccccacgacgaggacgcagccgccatccgcgcggacgtc
ctggcgggtgcggaacacgcacggagcagcgaatcgctgccctgcgagatcctggaggtc
ttccccagggacgaggccatccggcgcgcagtggagctcgctggcccttcggacagcatc
cttgtggccggccggggccatgaagtgtggcaggaagtcaaaggcgtcaatcttgccctt
gacgaccgcgtggaactgcgcagcgccttgacagccaggggattcaacgttctccaagac
gaccggatagagtcctag

DBGET integrated database retrieval system