KEGG   Pseudarthrobacter chlorophenolicus: Achl_1587Help
Entry
Achl_1587         CDS       T00834                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00520  Amino sugar and nucleotide sugar metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
Module
ach_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_1587
   00520 Amino sugar and nucleotide sugar metabolism
    Achl_1587
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Achl_1587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ACL39575
JGI: Achl1587
UniProt: B8HGY6
Position
complement(1776788..1777591)
Genome map
AA seq 267 aa AA seqDB search
MAKKDEKSHKNAPLIGIDIGGTGIKGGIVDLKKGKLLGDRFRVPTPQPATPESVAEAVAL
VVAELSARPEAPEAGSPVGVTFPGIIQHGVVHSAANVDKSWLDTDIDALLTARLGRPVEV
INDADAAGLAEARYGAGEGVKGTVLVITLGTGIGSAFIFDGKLVPNAELGHLEVDGVDAE
SKASAVARERDGLSWDEYSVLLQRYFSHVEFLFSPELFIVGGGISKRADEYLPNLKLRTP
IVPAVLRNEAGIVGAAVEIALQHKLTK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggccaagaaagacgagaagtcgcacaagaacgccccgctgatcggcatcgacatcgga
ggcacgggaatcaagggcggcatcgtcgacctgaaaaagggcaagctgctgggcgaccgg
ttccgcgtacccacgccgcagccggccaccccggagtccgtggccgaggccgtggccctg
gtggtggccgagctctccgcacgtcccgaggccccggaggccggctcgccggtcggtgtg
actttcccgggcatcatccagcacggcgttgtccactccgctgcgaatgtggacaagagc
tggctcgacaccgacatcgatgcgctcctcaccgcccggctgggccgccccgttgaggtc
atcaacgacgccgatgccgccggactcgcggaagcccgctacggtgcgggcgagggcgtc
aagggaaccgtcctggtcatcacgcttggcaccggaatcggctcggccttcatcttcgac
ggaaaactcgtgccgaatgccgagctgggccacctggaagtggacggcgtcgatgcagaa
tccaaggcgtccgccgtggcgcgtgagcgggacgggctgtcctgggacgaatacagcgtg
ctgctgcagcgctacttctcccacgtggagttcctgttctccccggaactgttcattgtg
ggcggcggcatctccaagcgtgccgacgaatacctgcccaaccttaagctccgcaccccg
attgtcccggcggtgctccggaacgaagccgggattgtgggcgccgcagtcgagatagca
ctccagcacaagctcaccaagtag

DBGET integrated database retrieval system