KEGG   Arthrobacter chlorophenolicus: Achl_1605Help
Entry
Achl_1605         CDS       T00834                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_1605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Achl_1605
  Amino acid metabolism
   00310 Lysine degradation
    Achl_1605
Enzymes [BR:ach01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Achl_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1798196..1799956)
Genome map
AA seq 586 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VAEDETAEVGAPLVRIGDGSGGGSAPAEEAPAAAPAEEAPAAEPAQEAPAAPAEEAPAAP
GAEAPAAGGGEGHDVTLPALGESVTEGTVTRWLKAVGDTVEVDEPLLEVSTDKVDTEIPS
PVAGTLQEIRVNEDETAEVGSVLAVIGSGAAAAPAEAPKAAPAQEAPKQEAPKAEAPKAE
APKQEAPKAAPAAAPAPAAAPAAQAAPAAAEAPAAGGESGYVTPLVRKLANQHGVDISSL
SGTGVGGRIRKQDVIAAAEAQAAPAAAPAAAPAASAPAAGNGQVSSLRGTTQKAPRIRQV
IARRMRESLEVSTQLTQVHEVDMTKVAKLRLKAKNSFQAQNGTKLTFLPFIAKAVAEALK
QHPKLNAAYDEDKQEITYHNAEHLAIAVDTDKGLLVPVISDAGNLNLAGLAGKIADVASR
TRDGKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRPVVVADENGDD
SIAIRSMMYLSLTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctgaagcaggtaggtgaccgggtagaggtggacgagccgctgctcgaggtctcc
accgacaaagtcgacaccgaaatcccctctcctgtcgctggcgtgattgaggaaatcctg
gttgccgaggacgaaaccgcagaggtcggcgcaccgctggtccgcatcggtgacggctcc
ggcggcggttccgcacccgccgaagaagcgcccgccgctgcacccgcagaagaggcaccc
gcggctgaacccgcccaggaagcacccgccgcacccgcagaggaagcaccggccgctcct
ggcgccgaagcacctgctgccggtggcggcgaaggccacgacgtcaccctccccgcactg
ggcgagagcgtcaccgaaggaaccgtcacacgctggctgaaggccgtgggtgacaccgta
gaggtcgatgagccgctgctcgaggtttccacggacaaggttgacaccgagatcccgtcc
cccgttgccggcaccctgcaggaaatccgcgtgaacgaggacgagaccgcagaggtcggt
tccgtccttgccgtcatcggttcgggcgctgcggctgctcccgcggaggctccgaaggct
gcccccgcccaggaagcacccaagcaggaggcaccgaaggctgaagcccccaaggcagag
gcacccaagcaggaagcaccgaaggccgctccggcagccgccccggctcctgctgccgca
cctgcagcgcaggccgcaccggcagcagccgaggcgccggcggcaggcggcgagtccggc
tacgttactcccctggtccgcaagctcgccaaccagcacggcgtggacatctcctcgctg
tccggcaccggcgtcggcggccgcatccgcaagcaggatgtcattgccgccgccgaggcg
caggccgcaccggcagcagctcccgcggcagcaccggccgcatccgcaccggcagccggc
aacggccaggtttcctcgctgcgcggcaccacccagaaggctccgcgcatccgccaggtc
atcgcccgccgcatgcgcgagtccctcgaggtttccacgcagctgacgcaggtccacgaa
gtggacatgaccaaggttgccaagctccgccttaaggccaagaactcgttccaggcccag
aacggcaccaagctgaccttcctgccgttcattgccaaggccgtggccgaggccctcaag
cagcaccccaagctcaacgctgcgtacgacgaggacaagcaggaaatcacgtaccacaac
gccgaacacctggcgatcgccgtcgataccgacaaaggcctcctggttccggtcatctcc
gacgccggcaacctgaacctggccggcctcgccggcaagatcgccgatgtggcttcccgt
acccgcgacggcaagatcggcccggacgagctgtccggcggcacgttcagcatcaccaac
atcggttcggtgggcgccctgtttgacacgccgatcatcaaccagccgcaggttggcatc
ctgggcaccggtgccatcgtcaagcgccccgtggtggtcgctgacgaaaacggtgacgac
tcgatcgccatccgctccatgatgtacctgtcgctgacgtacgaccaccgcctggtggac
ggcgctgacgccggccggttcctccagaccctgaaggcacgcctcgaagagggcgccttc
gaagcggacctgggcctctaa

DBGET integrated database retrieval system