KEGG   Arthrobacter chlorophenolicus: Achl_1605Help
Entry
Achl_1605         CDS       T00834                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_1605
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Achl_1605
  Amino acid metabolism
   00310 Lysine degradation
    Achl_1605
Enzymes [BR:ach01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Achl_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1798196..1799956)
Genome map
AA seq 586 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VAEDETAEVGAPLVRIGDGSGGGSAPAEEAPAAAPAEEAPAAEPAQEAPAAPAEEAPAAP
GAEAPAAGGGEGHDVTLPALGESVTEGTVTRWLKAVGDTVEVDEPLLEVSTDKVDTEIPS
PVAGTLQEIRVNEDETAEVGSVLAVIGSGAAAAPAEAPKAAPAQEAPKQEAPKAEAPKAE
APKQEAPKAAPAAAPAPAAAPAAQAAPAAAEAPAAGGESGYVTPLVRKLANQHGVDISSL
SGTGVGGRIRKQDVIAAAEAQAAPAAAPAAAPAASAPAAGNGQVSSLRGTTQKAPRIRQV
IARRMRESLEVSTQLTQVHEVDMTKVAKLRLKAKNSFQAQNGTKLTFLPFIAKAVAEALK
QHPKLNAAYDEDKQEITYHNAEHLAIAVDTDKGLLVPVISDAGNLNLAGLAGKIADVASR
TRDGKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRPVVVADENGDD
SIAIRSMMYLSLTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctgaagcaggtaggtgaccgggtagaggtggacgagccgctgctcgaggtctcc
accgacaaagtcgacaccgaaatcccctctcctgtcgctggcgtgattgaggaaatcctg
gttgccgaggacgaaaccgcagaggtcggcgcaccgctggtccgcatcggtgacggctcc
ggcggcggttccgcacccgccgaagaagcgcccgccgctgcacccgcagaagaggcaccc
gcggctgaacccgcccaggaagcacccgccgcacccgcagaggaagcaccggccgctcct
ggcgccgaagcacctgctgccggtggcggcgaaggccacgacgtcaccctccccgcactg
ggcgagagcgtcaccgaaggaaccgtcacacgctggctgaaggccgtgggtgacaccgta
gaggtcgatgagccgctgctcgaggtttccacggacaaggttgacaccgagatcccgtcc
cccgttgccggcaccctgcaggaaatccgcgtgaacgaggacgagaccgcagaggtcggt
tccgtccttgccgtcatcggttcgggcgctgcggctgctcccgcggaggctccgaaggct
gcccccgcccaggaagcacccaagcaggaggcaccgaaggctgaagcccccaaggcagag
gcacccaagcaggaagcaccgaaggccgctccggcagccgccccggctcctgctgccgca
cctgcagcgcaggccgcaccggcagcagccgaggcgccggcggcaggcggcgagtccggc
tacgttactcccctggtccgcaagctcgccaaccagcacggcgtggacatctcctcgctg
tccggcaccggcgtcggcggccgcatccgcaagcaggatgtcattgccgccgccgaggcg
caggccgcaccggcagcagctcccgcggcagcaccggccgcatccgcaccggcagccggc
aacggccaggtttcctcgctgcgcggcaccacccagaaggctccgcgcatccgccaggtc
atcgcccgccgcatgcgcgagtccctcgaggtttccacgcagctgacgcaggtccacgaa
gtggacatgaccaaggttgccaagctccgccttaaggccaagaactcgttccaggcccag
aacggcaccaagctgaccttcctgccgttcattgccaaggccgtggccgaggccctcaag
cagcaccccaagctcaacgctgcgtacgacgaggacaagcaggaaatcacgtaccacaac
gccgaacacctggcgatcgccgtcgataccgacaaaggcctcctggttccggtcatctcc
gacgccggcaacctgaacctggccggcctcgccggcaagatcgccgatgtggcttcccgt
acccgcgacggcaagatcggcccggacgagctgtccggcggcacgttcagcatcaccaac
atcggttcggtgggcgccctgtttgacacgccgatcatcaaccagccgcaggttggcatc
ctgggcaccggtgccatcgtcaagcgccccgtggtggtcgctgacgaaaacggtgacgac
tcgatcgccatccgctccatgatgtacctgtcgctgacgtacgaccaccgcctggtggac
ggcgctgacgccggccggttcctccagaccctgaaggcacgcctcgaagagggcgccttc
gaagcggacctgggcctctaa

DBGET integrated database retrieval system