KEGG   Arthrobacter chlorophenolicus: Achl_1682Help
Entry
Achl_1682         CDS       T00834                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ach01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ach00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1887957..1888778
Genome map
AA seq 273 aa AA seqDB search
MATVLDDINAGVREDMEARKRLVSLAELKDLALAAPPARDAWAALGGPATSRDQLKVIAE
IKRRSPSKGDLASIGDPASLARQYADGGAAVISVLTEQRRFNGSLADLDAVRAAVDIPLL
RKDFTLDEYQIWEARAHGADLILLIVAALSDAQLADFSALSHELGMNVLVETHTEEEIDR
AAAANARIIGVNVRNLKTLDVDRSVFASLAGRIPAGTVVVAESGVRGVDDVTHYAASGAD
AILVGEALVSHSTPLERIAEFTAAGAAAIAARG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgttctcgacgacatcaacgccggtgtccgggaggatatggaggccaggaaa
cggctcgtttccctggctgaactgaaggacctcgcgctggctgccccgcccgcccgtgac
gcctgggcggcactgggcggtccggcgacgtcgcgcgaccagctcaaggtcattgccgaa
atcaagcggcggagcccctccaagggggacctggccagcatcggcgaccccgcctccctc
gcacggcagtacgccgacggcggtgccgccgtcatcagtgtcctcaccgaacagcgccgc
ttcaacggctcccttgccgacctcgacgctgtccgcgccgccgtcgacatcccgctgctg
cgcaaggacttcaccctggatgagtaccagatctgggaagcccgggcgcatggtgcggac
ctgatcctgctgattgtcgccgcgctgtccgacgcccaactggccgacttcagcgcgctc
agccacgagctcggcatgaacgtcctcgtggaaacgcacacggaagaggaaatcgaccgc
gccgccgcggctaacgcccgcatcatcggcgtcaacgtgcgcaacctgaagacgctcgac
gtcgaccggtccgtgttcgcctcccttgcgggccgtattccggccggcacagtggtggta
gccgagtccggggtccgcggcgtggacgacgtcacgcactacgccgccagcggcgccgac
gccatcctggtgggcgaggccctggtcagccattccacgccgctggagcgcattgcggaa
tttaccgccgcaggtgcagctgccatcgcggcccggggctga

DBGET integrated database retrieval system