KEGG   Pseudarthrobacter chlorophenolicus: Achl_1683Help
Entry
Achl_1683         CDS       T00834                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00260  Glycine, serine and threonine metabolism
ach00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01130  Biosynthesis of antibiotics
ach01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_1683
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achl_1683
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Achl_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACL39670
JGI: Achl1683
UniProt: B8H6U9
Position
1888902..1890230
Genome map
AA seq 442 aa AA seqDB search
MADAPSGNADNKAADAFLQDGSLRHAPGPYFGSFGGRWMPESLIAALDELEETFDKARND
PDFRAQIADLNKNYSGRPSLLTEAKRFSEHAGGVRVFLKREDLNHTGSHKINNVLGQALL
AKRMGKTRIIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMELLGATVI
PVTSGSQTLKDAINEALRDWVANVANTHYLLGTAAGAHPFPAMVRYFHEVIGEEARAQIL
EQTGRLPDAVCACIGGGSNAIGIFHGFLDDPSVRIYGFEAGGDGVETGRHAATITLGKPG
VLHGARSYLMQDDDGQTIESHSISAGLDYPGVGPEHSYLSDIGRVSYEPITDSEAMDAFR
VLCRTEGIIPAIESAHALAGGIKVGQRLAAEAAESGETAADKIVIINLSGRGDKDVATAA
EWFDLLDKDSAESEIGKEGEQL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcaccttcaggaaacgctgacaacaaagccgcagacgcattcctgcaggac
ggctccctccggcacgccccggggccgtacttcgggtccttcggcggacgctggatgcct
gaatcgctcatcgctgccctggacgagctcgaggaaaccttcgacaaggccaggaacgat
ccggatttccgggcccagatcgcggacctgaacaagaactactccggccggccctcactg
ctcaccgaagcgaagcgtttctcggagcacgccgggggagtccgcgtcttcctcaagcgc
gaggacctgaaccacactggttcgcacaagatcaacaacgtcctggggcaggccttgctg
gccaagcggatgggcaagacccgcatcatcgccgagaccggagccgggcagcacggcgtt
gccagcgccactgcagctgcgctcctgggccttgagtgcgtcgtgtacatgggtgccgag
gactgccgccggcaggcgctcaacgtggcccgcatggagctgctcggcgccacggtcatc
cccgtgaccagcggctcgcagaccctgaaagacgccatcaacgaggccctccgcgactgg
gtggccaacgtggcgaacacccactacctgctgggtaccgccgcaggcgcccacccgttc
cccgccatggtccgctacttccacgaagtcatcggtgaggaagcccgcgcccagatcctt
gagcagaccggacgccttccggacgccgtctgcgcctgcatcggcggcgggtccaacgcc
atcggcatcttccatggcttcctcgacgacccgtccgtcaggatctacggcttcgaagcc
ggcggtgacggcgtggaaaccggacggcacgccgccaccatcacgctcggcaagccgggc
gtgctgcacggtgcccgttcctacctcatgcaagacgacgacggccagaccatcgagtcc
cactccatctccgccggactggactaccccggcgtcgggccggaacactcctacctgtcc
gacattggccgggtcagctacgagcccatcaccgacagtgaggcgatggacgcgttccgc
gtcctgtgccgcactgagggcatcatccccgccatcgagtccgcgcacgccctggccggc
ggcatcaaggtgggccagcggctcgccgccgaagcggccgaaagcggcgaaaccgccgcc
gacaagatcgtcatcatcaacctctccggacgcggtgacaaggacgtggccaccgccgcc
gaatggttcgacctgttggacaaggattccgccgaatcggaaatcggcaaagaaggggaa
cagctgtga

DBGET integrated database retrieval system