KEGG   Pseudarthrobacter chlorophenolicus: Achl_1684Help
Entry
Achl_1684         CDS       T00834                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Achl_1684
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_1684
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achl_1684
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Achl_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1890227..1891072
Genome map
AA seq 281 aa AA seqDB search
MSSAQAADKAQTTSKSAAAIDKARAEGRAALIGYLPAGYPTVEQTIAAGIALAENGADLI
EIGIPYSDPVMDGQVIQAATTEALANGFHVRQVFDVVEGITSKTDAAVLVMTYWNPVVRM
GVDEFSRRLAEAGGAGLITPDLIPDEAAEWFEASDKYGLDRVFLVAPSSTSERMQRTVDA
SRGFVYAVSIMGVTGARTSVSSAAKDVVSAAHAAGAERVCVGLGVSTAGQVREIAAYAEG
VIVGTALVAAVRDGGVDAVAALTKDLSTGLARETGNAGEEA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgcacaggcggccgacaaggcgcagaccaccagcaagtccgcggcagccatc
gacaaggcccgcgccgaaggccgcgccgcactgatcggctacctccccgcggggtacccc
acggtggagcagaccattgccgccggcatcgcactggccgagaacggcgccgacctgatc
gagatcggcatcccgtactcagaccccgtgatggacggccaggtcatccaggccgccacc
accgaggccctggccaacggcttccacgtccggcaggtcttcgacgtggtggaaggcatc
accagcaagactgatgccgccgtcctggtcatgacctactggaaccccgtggtccggatg
ggcgtggacgaattctcccgtcggctcgccgaggccgggggagcagggctcattaccccg
gacctgatcccggatgaggccgccgaatggtttgaagcgtccgacaagtacggcctggat
cgggtgttcctggtggccccgtcctccacctccgagcgcatgcagcgcaccgtcgacgcc
agccgcggctttgtctatgccgtatccatcatgggcgtcaccggcgcacgcacctccgtg
agttctgccgccaaggacgtggtgtccgccgcccacgcggcaggcgccgagcgtgtctgt
gttggcctgggtgtttcgaccgccgggcaggtgcgcgagatcgctgcgtacgccgaaggc
gtcatcgtgggcaccgcgctggtggcagccgtccgcgacggcggtgttgacgccgtcgcc
gccctcactaaggacctgagcacgggcctggcgcgggaaaccggcaacgccggggaagaa
gcctaa

DBGET integrated database retrieval system