KEGG   Arthrobacter chlorophenolicus: Achl_1684Help
Entry
Achl_1684         CDS       T00834                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Achl_1684 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Achl_1684 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Achl_1684 (trpA)
Enzymes [BR:ach01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Achl_1684 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1890227..1891072
Genome map
AA seq 281 aa AA seqDB search
MSSAQAADKAQTTSKSAAAIDKARAEGRAALIGYLPAGYPTVEQTIAAGIALAENGADLI
EIGIPYSDPVMDGQVIQAATTEALANGFHVRQVFDVVEGITSKTDAAVLVMTYWNPVVRM
GVDEFSRRLAEAGGAGLITPDLIPDEAAEWFEASDKYGLDRVFLVAPSSTSERMQRTVDA
SRGFVYAVSIMGVTGARTSVSSAAKDVVSAAHAAGAERVCVGLGVSTAGQVREIAAYAEG
VIVGTALVAAVRDGGVDAVAALTKDLSTGLARETGNAGEEA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagcgcacaggcggccgacaaggcgcagaccaccagcaagtccgcggcagccatc
gacaaggcccgcgccgaaggccgcgccgcactgatcggctacctccccgcggggtacccc
acggtggagcagaccattgccgccggcatcgcactggccgagaacggcgccgacctgatc
gagatcggcatcccgtactcagaccccgtgatggacggccaggtcatccaggccgccacc
accgaggccctggccaacggcttccacgtccggcaggtcttcgacgtggtggaaggcatc
accagcaagactgatgccgccgtcctggtcatgacctactggaaccccgtggtccggatg
ggcgtggacgaattctcccgtcggctcgccgaggccgggggagcagggctcattaccccg
gacctgatcccggatgaggccgccgaatggtttgaagcgtccgacaagtacggcctggat
cgggtgttcctggtggccccgtcctccacctccgagcgcatgcagcgcaccgtcgacgcc
agccgcggctttgtctatgccgtatccatcatgggcgtcaccggcgcacgcacctccgtg
agttctgccgccaaggacgtggtgtccgccgcccacgcggcaggcgccgagcgtgtctgt
gttggcctgggtgtttcgaccgccgggcaggtgcgcgagatcgctgcgtacgccgaaggc
gtcatcgtgggcaccgcgctggtggcagccgtccgcgacggcggtgttgacgccgtcgcc
gccctcactaaggacctgagcacgggcctggcgcgggaaaccggcaacgccggggaagaa
gcctaa

DBGET integrated database retrieval system