KEGG   Arthrobacter chlorophenolicus: Achl_1749Help
Entry
Achl_1749         CDS       T00834                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ach00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ach00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ach00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1974377..1976551)
Genome map
AA seq 724 aa AA seqDB search
MDPLHLRSAGTSLLISFDSGEAEVIHWGADLGAALPDLAVLTTPVGNSSVDARVPAALLP
QASSSWRGRPALRGNRITDGAPGLDFSSRLRVTSVDTAGAGRATVVQADADTGISVATVL
TLHPGGLLELRHTLTNNGTTPFQVDELATVLPVAPDAVELLDLTGRWCRERHPQRRPIQQ
GTWVRSGRHGRTGHDSSLLFAAGSQGFGNRHGKVWATHLAWSGNHEQFADTIGDGRTMIG
GSELLGSAEVILAPGGSYTTPALFAAFSDRGLDGITEAFYSWFRSRPHHILPGAKPRPVV
LNTWEAVYFNHDLDTLIELADSAADLGVERFVLDDGWFRGRRDDHAGLGDWYVDETLWPE
GLTPLIDAVTSRGMEFGLWVEPEMVNLDSDVARAHPEWISGPSAVAHKDGGRLPLEWRNQ
HVIDLVNPEAWQYVFDRISALLGENNISYLKWDQNRDIVEQGHAGRASVHEQTLAAYRLF
DELRKAHPGVEIESCSSGGGRVDLGILERTGRVWASDCNDALERQTIQRWTGAVVPPELV
GSHIGPTTSHTTARTHDLSFRAITAFFGHFGMEWDVRGVQGAEREELRRVVGLYKEHRDL
IHSGRPVHADIADEAYQLHGVASGEPAAEGTTAALFAFVCARTSGAEQPGRMGLPGLDPD
RTYRVDPIFPAPGDSDYGHTFTQVQPPAWLSDGATASGRFLAEVGLPMPMLNPEHAVLIK
VTAL
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggatcccctgcacctccgttccgccggcaccagcctgctgatcagcttcgacagcggg
gaggccgaggtcatccactggggcgcggacctgggtgcagcacttccagacctcgccgtc
ctcaccacgcccgtggggaattcctccgtggacgcccgcgtcccggccgcccttctccct
caggcctcctcgtcctggcggggccgtcccgccctccgcggcaaccggatcaccgacggc
gccccgggcctggacttctcctcccgcctccgcgtcacgtccgtggacaccgcaggcgcc
gggcgggccaccgttgtccaggccgacgccgacaccggcatcagcgtcgccaccgtcctg
acactgcacccgggcggcctgctggaactgcggcacacccttaccaacaacggcaccacc
cccttccaggtggacgaactggcgacggtcctccccgtggcgccggacgccgtcgaactc
ctcgacctgaccggacgctggtgccgcgaacgccacccgcagcggcggcccatccagcag
ggcacatgggtccgctccggacggcacggccgtactggccacgattcctctctcctgttc
gccgccggctcccagggtttcggcaatcggcacggcaaggtctgggccacccacctggca
tggagcggcaaccacgaacagttcgcggacaccatcggcgacgggcggaccatgatcggg
ggctcggaactgctgggctccgcggaggtcatcctcgccccgggcggcagctacaccaca
cctgccttgttcgctgcattttcggaccgcggcctggacggcatcaccgaggccttctac
agctggttccggtcccgcccgcaccacatccttccgggcgcgaagccgcgcccggtggtg
ctgaacacctgggaggccgtgtacttcaaccacgatctcgacaccctgatcgagctcgcc
gattccgccgcggacctcggcgtggagcgcttcgtgctcgacgacggctggttccgcggc
cgccgcgacgaccacgcgggcctgggcgactggtacgtggacgagaccctgtggcctgaa
gggctgacgccgctgatcgatgccgtcacctcccgggggatggagttcgggctgtgggtg
gaaccggagatggtcaacctggactcggatgttgcccgggcccacccggagtggatttcc
ggcccttccgcggtagcgcacaaggacggcggccggctgcccctcgaatggcgcaaccag
cacgtcatcgacctcgtcaacccggaagcctggcagtacgtcttcgaccggatctcggca
ctcctgggtgagaacaacatcagctacctcaagtgggaccagaaccgggacatcgttgaa
cagggccacgccggccgcgcgtccgtccatgaacaaaccctcgccgcctaccggctgttc
gacgagctccgcaaggcccatcccggcgtcgaaattgaaagctgctcctccggcggcgga
cgcgttgacctgggcatcctggagcggaccggacgcgtctgggcatcggactgcaacgac
gccctggaacggcagaccatccagcgctggaccggcgccgtggttccgccggagctcgtg
ggcagccacatcggccccaccacctcgcacaccaccgcccgcacccacgacctttccttc
cgtgccatcacagccttcttcggccacttcggcatggaatgggatgtccgcggcgtccag
ggcgcagaacgggaggagctgcggcgcgttgtcgggctctacaaggaacaccgggacctg
atccacagcggccggccggtccacgcggacatcgctgatgaggcctaccagctgcacggc
gtggcgtctggggaacctgctgcggagggtacgacggcggcgctgttcgccttcgtctgt
gcccgcacctcgggtgccgagcagccgggccggatgggcctgcccggactcgacccggac
cggacctaccgggtggaccccatcttcccggcccccggcgacagcgactacggacacacg
ttcacccaggtgcagccgccggcctggctcagtgacggcgcaacagccagcggccggttc
ctcgccgaagttggcctgccgatgccgatgctcaacccggaacacgcggtgctgatcaag
gtcacagcgctctag

DBGET integrated database retrieval system