KEGG   Arthrobacter chlorophenolicus: Achl_1768Help
Entry
Achl_1768         CDS       T00834                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Achl_1768
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_1768
  Lipid metabolism
   00071 Fatty acid degradation
    Achl_1768
  Amino acid metabolism
   00350 Tyrosine metabolism
    Achl_1768
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Achl_1768
   00626 Naphthalene degradation
    Achl_1768
Enzymes [BR:ach01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Achl_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1996318..1997361
Genome map
AA seq 347 aa AA seqDB search
MRAIVFKEWQQFPALEDVDRPVPGPGEVLLKVAGAGACHSDVSIFEDFTADVPGNMTKGF
VLGHENSGWVEELGAGVDGIEVGAAYLVGPIGCGHCKACSRGQDTYCENAATNPYLGIGL
GRDGGMAEYVTVPVRNLIPLGDADPIAAAPLADAALTPYHAIKTALPHLNGGGRYALVVG
LGGLGQIAVQILKALTGATVIATDMKPEAMAKAEAAGAITVPGGPDQVARIREITGGRGV
DAAFEFVGVTPTIATATGSMAVGGRLTVVGIAGGVHEWTFFNTPYESTITNTYWGTIEEL
HEVVDMYRAGQIIPEIETYSLEEGLTAYRKLAGGQLSARAVVVPHQA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatcgtattcaaggaatggcagcagtttcccgcactcgaggacgtggaccgg
cccgttccgggtccgggcgaggtgctgctgaaggtggccggcgccggagcctgccactct
gacgtcagcatcttcgaagacttcacagccgacgttcccgggaacatgaccaagggattc
gtgctgggccacgaaaactccggctgggtggaggaactgggcgcgggcgtggacggcatc
gaggtgggagccgcctacctggtcggccccatcggctgcggccactgcaaagcatgctcc
cgcggccaggacacctactgcgaaaacgccgcaaccaacccctacctgggcatcggcctg
ggccgcgacggcggcatggcagagtacgtcaccgtccccgtccgcaacctgatcccgctc
ggggatgcggaccccatcgcggcggcaccgctggccgacgccgccctgactccgtaccac
gccatcaagaccgccctgccgcacctgaacggcggcgggcgttatgcgctggtggtggga
ctcggcggcctgggacagattgccgtccagatcctcaaggcactcaccggagccaccgtc
atcgccacggacatgaagcccgaggcaatggccaaggcggaagccgcaggggccatcacg
gttcccggcggcccggaccaggtggcacggatccgggaaatcaccggcggccgcggcgtg
gacgccgcgttcgagttcgtcggtgtcaccccgacaatcgccaccgccaccggttcgatg
gccgtgggcgggcggctgaccgtcgtcgggattgccggcggcgtccacgaatggacgttc
ttcaacaccccctacgagtccaccatcaccaacacctactggggaaccattgaggaactc
cacgaggtggtggacatgtaccgggcagggcagatcataccggagatcgaaacctattcc
ctggaagaaggactcaccgcctaccggaaactggcaggcgggcagctgagcgcccgcgcc
gtggtggttccgcaccaggcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system