KEGG   Arthrobacter chlorophenolicus: Achl_1769Help
Entry
Achl_1769         CDS       T00834                                 

Definition
magnesium chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Achl_1769
Enzymes [BR:ach01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Achl_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1997450..1998886
Genome map
AA seq 478 aa AA seqDB search
MVESLDKGQDGDYRRGVTDRPEISSVGELRAAGHVLKDLRHEIRDNLLAALADGRDPWPG
LYGFGRTVLPQLERALIAGHDLVLLGERGQGKTRVLRTLAGLLDEWSPVIEGSELNEHPY
EPITEASRALASSEGERLRVAWRHRSERYVEKLATPDTSVADLIGDVDPMRVAEGRRLGD
PETIHYGLIPRSNRGIVAINELPDLAERIQVAMLNVMEERDIQIRGYVLRLPLDVLVVAS
ANPEDYTNRGRIITPLKDRFGAEIRTHYPIELEDEVAVIRQEGRLVADVPAVILEILARY
TRALRHSPAINQTSGVSARFAIAGAETVAAAALRRASLRGEDEAVARITDLEPAVEVLSG
KLEFESGEEGREQGILDHLLRTATAEAVRAHFQGIDMGPLVSALDGHRTVTTGGQVTAKE
FLDNLPSLNGSGLYDLIGKRMGAQNDGQRAAAVELALEGLYLGRRISKEADDDETVYG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatccctcgataaggggcaggacggggattaccgtagaggggtgactgaccgt
cccgaaatctcctctgttggcgaactgcgtgccgcgggccatgtcctgaaggacctgcgc
cacgaaatccgagacaacctgctggccgcgctcgcggacgggcgggatccctggcccggg
ctctacgggttcggccgtaccgtgctgccccagctggagcgggcgctgatcgccgggcat
gacctcgtgctgctgggcgagcgtggacagggcaagacccgggtgctgcgcacgctggcc
gggctgctcgacgaatggtcaccggtcattgagggctcggagctgaacgagcatccctac
gaaccaattacggaagcctcgcgcgcccttgcctcctctgagggggaacggctgcgggtt
gcctggcggcaccgctccgagcggtacgtggagaagctcgccactccagacacttccgta
gcggaccttatcggcgacgtggaccccatgcgggtggccgagggccgacgcctgggcgac
cctgagaccatccactacggactgattccgcgctccaaccggggcatcgtcgccatcaac
gaacttccggaccttgccgagcggatccaggtggccatgctcaacgtgatggaggagcgg
gacatccagatccgcggctacgtgctgcggctgccactggacgtcctggtggtggcatcg
gcgaacccggaggactacaccaaccgcggccggatcatcaccccgctgaaggaccgcttc
ggggccgagatccgtacccattaccccatcgagctggaagacgaggttgccgtcatccgg
caggaagggcggctggtggcggacgtgcccgccgtcatcctggagatcctcgcccggtac
acccgtgcgctgcggcattcaccggccatcaaccagacctcaggggtctccgcacggttc
gctattgccggcgcggagacggtggcagccgccgccctgcgccgggcaagcctccgcggc
gaagacgaagctgtggcccggatcaccgacctggaaccggcagtggaagtactcagcggc
aaactggaatttgaatcaggggaagagggccgcgagcagggcatcctggaccacctcctg
cgcaccgccaccgcagaagccgtcagggcccatttccagggcatcgatatggggccgctc
gtgtccgcgttggacggccacaggacagtgaccaccggcgggcaggtcacggcgaaggag
ttcctggacaacctcccctcgctgaacggatcaggtttgtacgacctgattggcaagcgc
atgggtgcgcagaacgacggacagcgcgccgccgccgtcgaacttgccctcgaagggctc
tacctcggccggcggatctccaaagaggccgacgacgacgaaacggtctacggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system