KEGG   Pseudarthrobacter chlorophenolicus: Achl_1830Help
Entry
Achl_1830         CDS       T00834                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00051  Fructose and mannose metabolism
ach00562  Inositol phosphate metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
ach01200  Carbon metabolism
ach01230  Biosynthesis of amino acids
Module
ach_M00002  Glycolysis, core module involving three-carbon compounds
ach_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_1830
   00051 Fructose and mannose metabolism
    Achl_1830
   00562 Inositol phosphate metabolism
    Achl_1830
Enzymes [BR:ach01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Achl_1830
Exosome [BR:ach04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Achl_1830
  Exosomal proteins of bladder cancer cells
   Achl_1830
  Exosomal proteins of melanoma cells
   Achl_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACL39806
JGI: Achl1830
UniProt: B8H7M6
Position
2073020..2073835
Genome map
AA seq 271 aa AA seqDB search
MTTSTNGAFDRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYSRVEVAVFPPFTDL
RGVQTLVQGDDLDVAYGGQDLSQFDSGAYTGDISGQFLSKLGCKYVLVGHSERRTIHNES
DDVLNAKTKAAFRHGVTPVLCVGEGLEIRKAGTHVNHTLDQLRAGVAGLTDDQAAELVVA
YEPVWAIGTGEVAGPEDAQEMCAAIRAELEKLFGADVAAKTRLLYGGSVKANNAAAILKE
RDVDGVLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacgtctaccaacggcgccttcgaccgtaagcccttcatcgccggcaactggaag
atgaacatggaccacgtgcagggcatcacgctcctgcagaagctggcctggacgctttcg
gacgccaagcacgactacagccgcgtcgaagttgcggtcttcccgcccttcacggacctc
cgcggcgtccagaccctcgtccagggtgacgacctggacgtggcctacggcggccaggac
ctttcccaatttgactccggcgcttacaccggcgacatctccggccagttcctgagcaag
ctgggctgcaagtacgtgctggtgggccacagcgaacgccgcaccatccacaacgaatcg
gacgacgtcctgaacgccaagaccaaggcggcattcaggcacggcgtcaccccggtcctc
tgcgtcggtgagggcctggagatccgcaaggccggcacgcacgtcaaccacaccctggac
cagcttcgcgccggcgtggcgggcctgaccgatgaccaggccgcagaactcgtcgttgcc
tacgaacccgtatgggccattgggacgggcgaggttgccggaccggaggacgcacaggag
atgtgcgccgccatccgggccgagctggagaagctgttcggggcggacgttgctgccaag
acgcggctgctgtacggcggctcagtcaaagccaacaacgctgcagccatcctgaaggag
cgcgacgttgacggcgtgctcgtgggtggcgccagcctggacccggccgagtttgctaat
attgtcaggttcgagagtcacctggtgacggactag

DBGET integrated database retrieval system