KEGG   Arthrobacter chlorophenolicus: Achl_1830Help
Entry
Achl_1830         CDS       T00834                                 

Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_1830
   01230 Biosynthesis of amino acids
    Achl_1830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_1830
   00051 Fructose and mannose metabolism
    Achl_1830
   00562 Inositol phosphate metabolism
    Achl_1830
Enzymes [BR:ach01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Achl_1830
Exosome [BR:ach04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Achl_1830
  Exosomal proteins of bladder cancer cells
   Achl_1830
  Exosomal proteins of melanoma cells
   Achl_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2073020..2073835
Genome map
AA seq 271 aa AA seqDB search
MTTSTNGAFDRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYSRVEVAVFPPFTDL
RGVQTLVQGDDLDVAYGGQDLSQFDSGAYTGDISGQFLSKLGCKYVLVGHSERRTIHNES
DDVLNAKTKAAFRHGVTPVLCVGEGLEIRKAGTHVNHTLDQLRAGVAGLTDDQAAELVVA
YEPVWAIGTGEVAGPEDAQEMCAAIRAELEKLFGADVAAKTRLLYGGSVKANNAAAILKE
RDVDGVLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgacaacgtctaccaacggcgccttcgaccgtaagcccttcatcgccggcaactggaag
atgaacatggaccacgtgcagggcatcacgctcctgcagaagctggcctggacgctttcg
gacgccaagcacgactacagccgcgtcgaagttgcggtcttcccgcccttcacggacctc
cgcggcgtccagaccctcgtccagggtgacgacctggacgtggcctacggcggccaggac
ctttcccaatttgactccggcgcttacaccggcgacatctccggccagttcctgagcaag
ctgggctgcaagtacgtgctggtgggccacagcgaacgccgcaccatccacaacgaatcg
gacgacgtcctgaacgccaagaccaaggcggcattcaggcacggcgtcaccccggtcctc
tgcgtcggtgagggcctggagatccgcaaggccggcacgcacgtcaaccacaccctggac
cagcttcgcgccggcgtggcgggcctgaccgatgaccaggccgcagaactcgtcgttgcc
tacgaacccgtatgggccattgggacgggcgaggttgccggaccggaggacgcacaggag
atgtgcgccgccatccgggccgagctggagaagctgttcggggcggacgttgctgccaag
acgcggctgctgtacggcggctcagtcaaagccaacaacgctgcagccatcctgaaggag
cgcgacgttgacggcgtgctcgtgggtggcgccagcctggacccggccgagtttgctaat
attgtcaggttcgagagtcacctggtgacggactag

DBGET integrated database retrieval system