KEGG   Arthrobacter chlorophenolicus: Achl_1985Help
Entry
Achl_1985         CDS       T00834                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Achl_1985
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Achl_1985
Exosome [BR:ach04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Achl_1985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2238917..2240431)
Genome map
AA seq 504 aa AA seqDB search
MNQYVIAIDQGTTSTRAIIFDHSGAIVSSGQMEHEQIFPKAGWVEHDAAEIWNNTREVIA
SALSKANLTRHDIAAVGITNQRETAVVWDKTTGEPVYNAIVWQDTRTQDIVDELSKDGGG
DRFKQKVGLPLATYFSGTKIKWILDNVDGAREKAEAGNLVFGNTDCWVLWNLTGGVDGGV
HVTDVTNASRTLFMDLETLQWDEEILGIFGVPRSMMPEIKSSSEVYGTVHTSQLLRETPV
AGILGDQQAATFGQAAFETGEAKNTYGTGCFLIFNTGEEIVHSKNGLLTTVGYKLGDAKP
HYALEGSIAVTGSLIQWLRDNLGMISSAPEVETLAASVKDNGGVYIVPAFSGLFAPYWRP
DARGAIVGLTRFVNKNHIARAALESTAFQTREVLDAVNADSGVPLTELKVDGGMVANDAL
MQFQADILGVPVIRPKVIETTALGAAYAAGLAVGFWKDLGELSSNWSEDKRWEPQLDQAE
QERQMRLWRKAVTKSMDWVDEDVK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtacgtaatcgccattgaccagggcaccaccagtacgcgcgccatcatcttt
gaccacagcggcgccattgtctcctcgggccagatggaacacgagcagatcttccccaaa
gcaggatgggtggagcacgatgccgcggaaatctggaacaacacccgtgaggtcattgcc
tccgccctgtccaaggcgaacctgacgcggcacgacatcgccgccgtcggcatcaccaac
cagcgtgaaaccgctgtggtgtgggacaagaccaccggcgagcccgtgtacaacgccatc
gtgtggcaggacacccggacgcaggacatcgtcgacgaactgtccaaggacggcggcggt
gaccgcttcaaacagaaggtgggcctgccgctggcaacttacttctccggcaccaaaatc
aaatggatcctggacaacgtggacggcgcccgcgaaaaggcggaggccggcaacctggtc
ttcggcaacaccgactgctgggtgttgtggaacctcaccggcggcgtggacggcggggtg
cacgtcaccgacgtcacgaacgcatcccggacgcttttcatggacctggaaaccctgcag
tgggacgaggagatcctcggcatcttcggtgttccgcgcagcatgatgccggagatcaag
tcgtcctccgaggtgtacggcactgtccacacctcgcaactgctgcgtgaaaccccggtg
gcgggcatcctgggcgaccagcaggcggccaccttcggccaggcggccttcgaaacgggc
gaggccaagaacacgtacggcaccggctgcttcctgattttcaacaccggggaggaaatc
gtccattcgaagaacgggctgctcaccacggtgggctacaagctgggcgacgccaagccc
cactacgcgctggaaggttcaatcgccgtcacgggttcgctgatccagtggctgcgggac
aacctgggcatgatcagcagcgcccccgaggtcgaaaccctggctgcctccgtcaaggac
aacggcggcgtctacatcgtcccggcgttctcgggcctgttcgcgccgtactggcgcccg
gatgctcgcggcgcgattgttggcctcaccaggttcgtcaacaagaaccacattgcccgg
gcggcgctggagtcaacggcgttccagacccgtgaggtgctggacgccgtcaacgcggac
tccggtgttccgctgacggagttgaaggtcgacggcggcatggtcgccaatgacgcgctg
atgcagttccaggcggacatcctcggcgttcccgtgatccgtccgaaggtcatcgagacc
acagctttgggtgcagcatatgcggccgggctggccgtcgggttctggaaggacctcggc
gaactctcgtccaactggtccgaggacaagcgctgggaaccccagctggaccaggccgag
caggaacgccagatgcggctctggcgcaaggcggtcaccaagtccatggactgggtcgac
gaggacgtgaagtag

DBGET integrated database retrieval system