KEGG   Pseudarthrobacter chlorophenolicus: Achl_1996Help
Entry
Achl_1996         CDS       T00834                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00230  Purine metabolism
ach01100  Metabolic pathways
Module
ach_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Achl_1996
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Achl_1996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18
Motif
Other DBs
NCBI-ProteinID: ACL39970
JGI: Achl1996
UniProt: B8H8U2
Position
complement(2252277..2252870)
Genome map
AA seq 197 aa AA seqDB search
MSKKPGLTVLAGPTAVGKGTVSTYIRDNYPEVWLSVSATTRAPRPGEVDGVHYFFKSTEE
FERLIAEGELLEWAVVHGQNTYGTLKSTVNEAIAEGRSVLLEIDLQGARQVKEAVPDAKF
VFLAPPTWDEMVRRLVGRGTETPEEQQRRLETAKLELAAEPEFDHTVINDDVRRAADELV
SLMGLTPHAHLQEPSAR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagaaacccggactgacagtcctcgcaggtccgacagctgttggcaaaggcacc
gtatccacctatatccgcgacaactaccctgaggtctggctttctgtctcagcaaccacc
cgcgccccgcgcccgggtgaagtggacggcgttcactatttcttcaagtccacggaagag
tttgaacggctcatcgcggagggcgaactcctcgagtgggccgtcgtgcacggccagaac
acttatggcacgttgaagagcaccgtgaacgaggccattgcagagggtcgctccgtcctg
ctggaaatcgacctccagggtgcgcggcaggtcaaggaagccgttccggacgcgaagttc
gtgttcctcgccccgcccacctgggacgaaatggtgcgccgcctcgtgggacgcggcaca
gaaacccccgaagaacagcagcgccggctggaaaccgctaaactggaacttgctgctgaa
ccggagttcgaccacaccgtcatcaatgacgacgtccgccgggcagcggacgagcttgtt
tcactcatggggctgacccctcatgcacacctgcaggaaccgtcagcccgctag

DBGET integrated database retrieval system