KEGG   Pseudarthrobacter chlorophenolicus: Achl_2003Help
Entry
Achl_2003         CDS       T00834                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00240  Pyrimidine metabolism
ach00250  Alanine, aspartate and glutamate metabolism
ach01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Achl_2003
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Achl_2003
Enzymes [BR:ach01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Achl_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACL39977
JGI: Achl2003
UniProt: B8H8U9
Position
complement(2260715..2261743)
Genome map
AA seq 342 aa AA seqDB search
MKHLLSTQDLSLHNAIRILDTAEEMSAVGDREVKKLPALRGRTVVNLFFEDSTRTRISFE
AAAKRLSADVINFAAKGSSVSKGESLKDTAQTLSAMGADAVVIRHWASGAPHRLAATDWI
DAGVINAGDGTHEHPTQALLDAFTMRRHWAKLSGTPSEGADLKGMRVAIAGDVLHSRVAR
SNVWLLRTLGAEVTLVAPPTLLPIGVEKWPCAVSYDLDETLARGVDAVMMLRVQGERMNA
SFFPSTREYSRRWGFDDNRLRALDSLGMKDTIIMHPGPMNRGLEISAAAADSPRSTVLAQ
VRNGVSVRMAALYLLLSGDTRETAAPPVLAAAGTAHSTKESI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacacctgctctccacccaggacctcagcctgcacaacgccatccgcatcctcgac
accgccgaggagatgtcggcagtaggcgaccgcgaagtgaagaagcttcccgccctgcgc
ggccgcacggtggtgaacctcttcttcgaagactccacccgcaccaggatttccttcgaa
gcggcggccaagcggttgtccgctgacgtcatcaacttcgcggccaaaggatcatcggtc
tccaagggtgaatcgctcaaggacaccgcccagacgctgtccgcgatgggggcggacgcc
gtcgtcatccgccactgggcctccggtgcaccgcaccggctcgccgcgacggactggatc
gacgccggagtcatcaacgccggtgacggcacccacgaacaccccacccaggcacttctg
gacgccttcaccatgcggcggcactgggcgaagctgtcaggtaccccttccgaaggcgcc
gacctgaagggaatgcgcgtggcgatcgccggcgatgtcctgcactcccgcgtggcccgt
tccaacgtctggctcctgcgcacgctgggtgcggaagtcaccctggtggcgccccctacg
ctgctgcccatcggcgtcgagaagtggccctgcgccgtcagctacgacctcgacgaaact
ctcgcccggggcgtcgacgcagtcatgatgctccgtgtccagggcgaacgcatgaacgct
tccttcttccccagcacccgtgagtactcacgccgctggggcttcgatgacaaccgactg
cgcgccctcgacagcctgggcatgaaggacaccatcatcatgcacccgggccccatgaac
cgggggctcgaaatcagcgcagccgcagcagactcaccccgttccaccgtcctcgcgcag
gtccgcaacggcgtgtccgtgcggatggcggcgctgtacctgctgctctccggggacacc
cgggaaacagccgcacccccggtcctggccgctgccggaaccgcccattccaccaaggag
agcatctga

DBGET integrated database retrieval system