KEGG   Arthrobacter chlorophenolicus: Achl_2175Help
Entry
Achl_2175         CDS       T00834                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ach00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ach00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2447155..2448342
Genome map
AA seq 395 aa AA seqDB search
MTLSPTTADKFTFGLWTVGWTGADPFGVATRAALDPVEAVHKLSELGAYGITFHDNDLVP
FDAPASERELILKNFRAALADTGLKVPMVTTNLFSHPVFKDGGFTSNDRSVRRFALSKVL
RNIDLAAELGAETFVMWGGREGSEYDGSKDLAAALDRMKEGVDTAAGYIKDKGYNLRIAL
EPKPNEPRGDIFLPTVGHGLAFIAQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAGK
LFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPGGGPKYDGPRHFDYKPSRTD
GYDGVWESAKANMAMYLLLKERALAFRADPEVQEALAASGVFELGEPTLNAGETTADLLA
DAASFEDFDADKAAERSFAFVRLNQLAIEHLLNAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactctctcccccaccactgccgacaagttcacctttggcctctggacggtgggctgg
accggcgcggacccgttcggtgtagccacccgcgcggcgcttgacccggtggaagccgtc
cataaactcagcgaactgggcgcctacggcatcactttccacgacaacgacctggttccc
ttcgatgcccccgcctccgagcgcgaactgatcctcaagaacttccgcgcagccctggca
gacaccgggctcaaggtgccgatggtcaccaccaacctcttcagccacccggtcttcaag
gacggcggcttcacctccaacgaccgctccgtgcgccggttcgccctgtccaaggtgctc
cgcaacatcgacctcgccgcagaactcggcgccgaaaccttcgtcatgtggggcggccgc
gaaggcagcgaatacgacggctccaaagacctcgctgcagcgctggaccgcatgaaggaa
ggcgtggacaccgccgccggctacatcaaggacaagggctacaacctgcgcatcgccctc
gagcccaagcccaacgaaccccgcggtgacatcttcctgcccaccgtcggacacggcctg
gcattcatcgcccagctcgaacacggcgacatcgtgggcctgaaccccgaaaccggccac
gaacaaatggccggactgaacttcacccacggcatcgcccaggcactctgggcaggcaag
ctgttccacatcgacctcaacgggcagcgcggcatcaagtacgaccaggacctcgtcttc
ggccacggcgacctcaccagcgccttcttcaccgtcgacctcctcgaaaacggcttcccg
ggaggcggaccgaagtacgacggcccccgccacttcgactacaagccctcccgcaccgac
ggctacgacggcgtctgggaatccgccaaggccaacatggccatgtacctgctgctgaag
gaacgggcactggccttccgcgccgaccccgaagtccaggaagccctggcagcgtcaggc
gtcttcgaactcggcgaacccaccctcaacgccggcgaaaccaccgccgacctgctcgcg
gacgccgcatcctttgaagacttcgacgccgacaaggccgccgaacgctccttcgccttc
gtccggctcaaccagctcgccatcgaacacctcctcaacgcccgctga

DBGET integrated database retrieval system