KEGG   Arthrobacter chlorophenolicus: Achl_2319Help
Entry
Achl_2319         CDS       T00834                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Achl_2319
Enzymes [BR:ach01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Achl_2319
    3.5.1.-  
     Achl_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2606668..2607291
Genome map
AA seq 207 aa AA seqDB search
MSRALIIVDVQNDFCEGGSLAVDGGAAVAGAISEYVDAHHNEFDHIVATQDWHIDPGSHF
SENPDFKDSWPAHCVAGTRGAELHPDLDTEYIEAYFRKGQYAAAYSGFEGLLAPEDAVPT
GERQAGSNADALEEDGDAVGLDDWLQSHDVEDVVVVGIATDYCVRATSLDAVQAGYSVTV
VRSLTAGIAEDLEETVAEMELGGVDIA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgcactgattattgtcgacgtccagaacgacttctgcgagggcgggtcgctt
gccgttgacggcggcgctgccgtggccggcgccatcagcgaatacgtcgacgcccaccac
aacgaattcgaccatattgtcgccacccaggactggcacatcgatccgggcagccacttt
tccgaaaaccctgatttcaaggacagctggccggcgcactgcgtggccggaacccgcggc
gcggagctccatccggacctggacaccgaatacatcgaggcgtatttccggaagggccag
tacgctgccgcgtactcgggcttcgaagggctgctggcacccgaggacgccgtccccacc
ggggagcggcaggccgggtcaaatgcggacgcccttgaggaggacggagacgccgtcggc
cttgacgactggctgcagagccatgacgttgaagacgttgtggtggtggggatcgccacc
gactactgcgtgcgggccacgtcactcgacgccgtccaggcggggtattcagtcaccgtg
gtccgctccctgacggcaggcattgccgaggacctggaagagaccgtcgcggagatggaa
ctcggcggcgtggacatcgcctga

DBGET integrated database retrieval system