KEGG   Arthrobacter chlorophenolicus: Achl_2319Help
Entry
Achl_2319         CDS       T00834                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ach00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2606668..2607291
Genome map
AA seq 207 aa AA seqDB search
MSRALIIVDVQNDFCEGGSLAVDGGAAVAGAISEYVDAHHNEFDHIVATQDWHIDPGSHF
SENPDFKDSWPAHCVAGTRGAELHPDLDTEYIEAYFRKGQYAAAYSGFEGLLAPEDAVPT
GERQAGSNADALEEDGDAVGLDDWLQSHDVEDVVVVGIATDYCVRATSLDAVQAGYSVTV
VRSLTAGIAEDLEETVAEMELGGVDIA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgcactgattattgtcgacgtccagaacgacttctgcgagggcgggtcgctt
gccgttgacggcggcgctgccgtggccggcgccatcagcgaatacgtcgacgcccaccac
aacgaattcgaccatattgtcgccacccaggactggcacatcgatccgggcagccacttt
tccgaaaaccctgatttcaaggacagctggccggcgcactgcgtggccggaacccgcggc
gcggagctccatccggacctggacaccgaatacatcgaggcgtatttccggaagggccag
tacgctgccgcgtactcgggcttcgaagggctgctggcacccgaggacgccgtccccacc
ggggagcggcaggccgggtcaaatgcggacgcccttgaggaggacggagacgccgtcggc
cttgacgactggctgcagagccatgacgttgaagacgttgtggtggtggggatcgccacc
gactactgcgtgcgggccacgtcactcgacgccgtccaggcggggtattcagtcaccgtg
gtccgctccctgacggcaggcattgccgaggacctggaagagaccgtcgcggagatggaa
ctcggcggcgtggacatcgcctga

DBGET integrated database retrieval system