KEGG   Pseudarthrobacter chlorophenolicus: Achl_2553Help
Entry
Achl_2553         CDS       T00834                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00220  Arginine biosynthesis
ach00250  Alanine, aspartate and glutamate metabolism
ach00290  Valine, leucine and isoleucine biosynthesis
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01130  Biosynthesis of antibiotics
ach01210  2-Oxocarboxylic acid metabolism
ach01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Achl_2553
   00290 Valine, leucine and isoleucine biosynthesis
    Achl_2553
   00220 Arginine biosynthesis
    Achl_2553
Enzymes [BR:ach01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Achl_2553
    2.6.1.66  valine---pyruvate transaminase
     Achl_2553
Amino acid related enzymes [BR:ach01007]
 Aminotransferase (transaminase)
  Class I
   Achl_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: ACL40518
JGI: Achl2553
UniProt: B8HCA2
Position
complement(2872575..2873795)
Genome map
AA seq 406 aa AA seqDB search
MAEFRQSTKLNNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDSGD
EVLIPTPDYPLWTASVALAGGKPVHYLCDEESGWQPDLEDMEAKITPRTKGIVVINPNNP
TGAVYPEETLKRIVALAEKHGLVLFADEIYEKILYEDAVHVNMAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYEMLNAIPGVSTQQAKGALYLFPRLDPEVYHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAVGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaggcagtccacgaagctcaacaacgtcctttacgacatccgtggaccc
atcctgcaggccgcccagcaaatggaagcggagggccaccgcatcctgaagctgaacatc
ggtaatcccgccccgttcggattcgaggctcccgacgccattctggtggacatgatccgc
cacctgccgcacgcccagggctacagcgattcccgaggcatcttctcggcccgcaccgcc
gtctcgcagtactaccagacccgcggtatccagaacatccacgtagacgacatctacttg
ggaaacggcgtcagcgaactgatcaccatgtcgctgatggccctcctggattccggcgac
gaagtcctcatccccactccggactacccgctgtggacagcatccgtggccctcgccggc
ggaaagcccgtgcactacctgtgcgacgaggaatccggctggcagcctgaccttgaggac
atggaagcgaagatcacgccccgcaccaagggcatcgtggtgatcaaccccaacaacccc
accggtgccgtctaccccgaagagacgctgaagcggatcgttgccctggccgaaaagcat
ggcctggtgctcttcgccgatgagatctacgaaaagatcctctacgaggacgccgtccac
gtgaacatggccgggctgaccggtgacgacgtcctgtgcctgaccttcagcggactgtcc
aaggcctaccgtgtctgcgggtaccgggccggttggatggcaatttcaggccccaagaaa
gacgctgcggactacctagagggcatcagcctcctggccaacatgcgcctgtgcgccaat
gttcccgcccagcacgccatccagacggcccttggcgggtaccagagcatcaacgacctc
atcctgcccggcggccggctgctcgaacagcgcaacaaggcctacgagatgctcaacgcc
attccgggtgtcagcacccagcaggccaagggagccctgtacctgttcccacggcttgac
cccgaggtctatcacatccgcgacgacgagaagtttgtcctggatctactgcgtgagcag
aaaatcctggtatcccatggccgggccttcaactgggtgcggccggaccacttccgcatg
gtgaccctgcccaacgtcaaggacatcgaagaagctgttggccggatgggggacttcctc
agcaggtaccaggggaactag

DBGET integrated database retrieval system