KEGG   Arthrobacter chlorophenolicus: Achl_2553Help
Entry
Achl_2553         CDS       T00834                                 

Definition
aminotransferase AlaT
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Achl_2553
   01230 Biosynthesis of amino acids
    Achl_2553
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Achl_2553
   00290 Valine, leucine and isoleucine biosynthesis
    Achl_2553
Enzymes [BR:ach01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Achl_2553
    2.6.1.66  valine---pyruvate transaminase
     Achl_2553
Amino acid related enzymes [BR:ach01007]
 Aminotransferase (transaminase)
  Class I
   Achl_2553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2872575..2873795)
Genome map
AA seq 406 aa AA seqDB search
MAEFRQSTKLNNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDSGD
EVLIPTPDYPLWTASVALAGGKPVHYLCDEESGWQPDLEDMEAKITPRTKGIVVINPNNP
TGAVYPEETLKRIVALAEKHGLVLFADEIYEKILYEDAVHVNMAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYEMLNAIPGVSTQQAKGALYLFPRLDPEVYHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAVGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaggcagtccacgaagctcaacaacgtcctttacgacatccgtggaccc
atcctgcaggccgcccagcaaatggaagcggagggccaccgcatcctgaagctgaacatc
ggtaatcccgccccgttcggattcgaggctcccgacgccattctggtggacatgatccgc
cacctgccgcacgcccagggctacagcgattcccgaggcatcttctcggcccgcaccgcc
gtctcgcagtactaccagacccgcggtatccagaacatccacgtagacgacatctacttg
ggaaacggcgtcagcgaactgatcaccatgtcgctgatggccctcctggattccggcgac
gaagtcctcatccccactccggactacccgctgtggacagcatccgtggccctcgccggc
ggaaagcccgtgcactacctgtgcgacgaggaatccggctggcagcctgaccttgaggac
atggaagcgaagatcacgccccgcaccaagggcatcgtggtgatcaaccccaacaacccc
accggtgccgtctaccccgaagagacgctgaagcggatcgttgccctggccgaaaagcat
ggcctggtgctcttcgccgatgagatctacgaaaagatcctctacgaggacgccgtccac
gtgaacatggccgggctgaccggtgacgacgtcctgtgcctgaccttcagcggactgtcc
aaggcctaccgtgtctgcgggtaccgggccggttggatggcaatttcaggccccaagaaa
gacgctgcggactacctagagggcatcagcctcctggccaacatgcgcctgtgcgccaat
gttcccgcccagcacgccatccagacggcccttggcgggtaccagagcatcaacgacctc
atcctgcccggcggccggctgctcgaacagcgcaacaaggcctacgagatgctcaacgcc
attccgggtgtcagcacccagcaggccaagggagccctgtacctgttcccacggcttgac
cccgaggtctatcacatccgcgacgacgagaagtttgtcctggatctactgcgtgagcag
aaaatcctggtatcccatggccgggccttcaactgggtgcggccggaccacttccgcatg
gtgaccctgcccaacgtcaaggacatcgaagaagctgttggccggatgggggacttcctc
agcaggtaccaggggaactag

DBGET integrated database retrieval system