KEGG   Arthrobacter chlorophenolicus: Achl_2715Help
Entry
Achl_2715         CDS       T00834                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ach  Arthrobacter chlorophenolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Achl_2715
   01230 Biosynthesis of amino acids
    Achl_2715
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_2715
   00030 Pentose phosphate pathway
    Achl_2715
   00051 Fructose and mannose metabolism
    Achl_2715
   00052 Galactose metabolism
    Achl_2715
  Energy metabolism
   00680 Methane metabolism
    Achl_2715
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Achl_2715
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Achl_2715
Protein phosphatases and associated proteins [BR:ach01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Achl_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3040587..3041612
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDIIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPEVIKAHMDRLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKVSIEQITEWVNEAHARGRAPLVVVAEGFVPEHMESPHSERGLDTF
GRPRLGGIADQLAPELEARTGIETRATILGHIQRGGVPSAFDRVLATRLGMAAIDSVVEG
FWGTMVALKGTDIQHVAFEEALGQLKTVPQNRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaatcctcaccagcggtggcgactgccccggactgaacgcggtcatccgc
ggcgccgtgctgaagggcatcgccatccacggccacgagttcgtcggattcctcgacggc
tggcgcggcgtggtggagggcgacatcatcgacatcccgcgcaccatggtgcgcggtatc
gccaagcagggcggcaccatcctgggcacctcccgcaccaaccccttcgaaaacggcggc
ggccccgaggtcatcaaagcccacatggaccggctgggcatcgacgccatcatcgccatc
ggcggtgagggaacccttgccgcggccaagcgcctgaccgacgccggcctgaagatcgtg
ggcgtccccaagactgtggacaacgacctcgacgccaccgactacaccttcggtttcgac
accgcagtgcagattgccaccgaagccatcgaccggctccggaccaccggcgaatcccac
caccgctgcatgatcgccgaggtcatgggccggcacgtgggctggattgccctgcacgcc
ggcatggcggccggcgcccacgccatcctcattccggagcagaaggtcagcatcgagcag
atcactgaatgggtgaacgaagcccacgcccgcggccgcgcgccgctggtggtagtggcc
gaagggttcgtgcccgagcacatggaatccccccactccgagcgcggcctggacactttc
ggccgtccccgcctgggcggtatcgccgaccagctcgcgccagaactggaagcccgcacc
ggcatcgaaacccgcgccaccatcctgggccacatccagcgcggcggcgtcccctcggcc
ttcgaccgcgtcctcgccacgcgcctgggcatggccgccatcgactccgtggtggaaggc
ttctggggaaccatggttgcgctcaagggcaccgacatccagcacgtcgccttcgaggaa
gccctgggccagctgaagaccgtgccgcagaaccggtacgacgaagccgcggtcctgttc
ggctaa

DBGET integrated database retrieval system