KEGG   Pseudarthrobacter chlorophenolicus: Achl_2715Help
Entry
Achl_2715         CDS       T00834                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ach  Pseudarthrobacter chlorophenolicus
Pathway
ach00010  Glycolysis / Gluconeogenesis
ach00030  Pentose phosphate pathway
ach00051  Fructose and mannose metabolism
ach00052  Galactose metabolism
ach00680  Methane metabolism
ach01100  Metabolic pathways
ach01110  Biosynthesis of secondary metabolites
ach01120  Microbial metabolism in diverse environments
ach01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ach00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Achl_2715
   00030 Pentose phosphate pathway
    Achl_2715
   00051 Fructose and mannose metabolism
    Achl_2715
   00052 Galactose metabolism
    Achl_2715
  Energy metabolism
   00680 Methane metabolism
    Achl_2715
Enzymes [BR:ach01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Achl_2715
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Achl_2715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACL40680
JGI: Achl2715
UniProt: B8HD34
Position
3040587..3041612
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDIIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPEVIKAHMDRLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKVSIEQITEWVNEAHARGRAPLVVVAEGFVPEHMESPHSERGLDTF
GRPRLGGIADQLAPELEARTGIETRATILGHIQRGGVPSAFDRVLATRLGMAAIDSVVEG
FWGTMVALKGTDIQHVAFEEALGQLKTVPQNRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaatcctcaccagcggtggcgactgccccggactgaacgcggtcatccgc
ggcgccgtgctgaagggcatcgccatccacggccacgagttcgtcggattcctcgacggc
tggcgcggcgtggtggagggcgacatcatcgacatcccgcgcaccatggtgcgcggtatc
gccaagcagggcggcaccatcctgggcacctcccgcaccaaccccttcgaaaacggcggc
ggccccgaggtcatcaaagcccacatggaccggctgggcatcgacgccatcatcgccatc
ggcggtgagggaacccttgccgcggccaagcgcctgaccgacgccggcctgaagatcgtg
ggcgtccccaagactgtggacaacgacctcgacgccaccgactacaccttcggtttcgac
accgcagtgcagattgccaccgaagccatcgaccggctccggaccaccggcgaatcccac
caccgctgcatgatcgccgaggtcatgggccggcacgtgggctggattgccctgcacgcc
ggcatggcggccggcgcccacgccatcctcattccggagcagaaggtcagcatcgagcag
atcactgaatgggtgaacgaagcccacgcccgcggccgcgcgccgctggtggtagtggcc
gaagggttcgtgcccgagcacatggaatccccccactccgagcgcggcctggacactttc
ggccgtccccgcctgggcggtatcgccgaccagctcgcgccagaactggaagcccgcacc
ggcatcgaaacccgcgccaccatcctgggccacatccagcgcggcggcgtcccctcggcc
ttcgaccgcgtcctcgccacgcgcctgggcatggccgccatcgactccgtggtggaaggc
ttctggggaaccatggttgcgctcaagggcaccgacatccagcacgtcgccttcgaggaa
gccctgggccagctgaagaccgtgccgcagaaccggtacgacgaagccgcggtcctgttc
ggctaa

DBGET integrated database retrieval system